BLASTX nr result
ID: Atropa21_contig00016038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00016038 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235554.1| PREDICTED: U6 snRNA-associated Sm-like prote... 83 3e-14 ref|XP_002331181.1| predicted protein [Populus trichocarpa] gi|5... 80 2e-13 ref|XP_006357408.1| PREDICTED: U6 snRNA-associated Sm-like prote... 80 4e-13 ref|XP_004241918.1| PREDICTED: U6 snRNA-associated Sm-like prote... 80 4e-13 ref|XP_002532727.1| lsm1, putative [Ricinus communis] gi|2235275... 80 4e-13 ref|XP_002304120.1| small nuclear ribonucleoprotein [Populus tri... 79 5e-13 ref|XP_003633086.1| PREDICTED: U6 snRNA-associated Sm-like prote... 78 1e-12 gb|EXC32300.1| Nucleoside diphosphate kinase 6 [Morus notabilis] 77 2e-12 ref|XP_004303709.1| PREDICTED: U6 snRNA-associated Sm-like prote... 77 3e-12 gb|EMJ04688.1| hypothetical protein PRUPE_ppa022434mg, partial [... 77 3e-12 ref|XP_002271476.1| PREDICTED: U6 snRNA-associated Sm-like prote... 75 7e-12 ref|XP_004287651.1| PREDICTED: U6 snRNA-associated Sm-like prote... 75 9e-12 gb|EMJ16349.1| hypothetical protein PRUPE_ppa013348mg [Prunus pe... 74 2e-11 gb|AFK42388.1| unknown [Medicago truncatula] 74 2e-11 ref|XP_003595339.1| U6 snRNA-associated Sm-like protein LSm1 [Me... 74 2e-11 ref|XP_002516250.1| lsm1, putative [Ricinus communis] gi|2235447... 74 3e-11 ref|XP_006426701.1| hypothetical protein CICLE_v10026767mg [Citr... 73 3e-11 ref|XP_006836602.1| hypothetical protein AMTR_s00131p00107350 [A... 73 5e-11 gb|EOY27290.1| Small nuclear ribonucleoprotein family protein is... 73 5e-11 ref|XP_004510523.1| PREDICTED: U6 snRNA-associated Sm-like prote... 73 5e-11 >ref|XP_004235554.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Solanum lycopersicum] gi|565351988|ref|XP_006342929.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm1-like [Solanum tuberosum] Length = 128 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVSEAEIRRAQKAERD+TDLKGSMRKRMEFLDMD Sbjct: 88 ELPPHMTRVSEAEIRRAQKAERDSTDLKGSMRKRMEFLDMD 128 >ref|XP_002331181.1| predicted protein [Populus trichocarpa] gi|566149434|ref|XP_006369123.1| small nuclear ribonucleoprotein [Populus trichocarpa] gi|118489961|gb|ABK96777.1| unknown [Populus trichocarpa x Populus deltoides] gi|550347483|gb|ERP65692.1| small nuclear ribonucleoprotein [Populus trichocarpa] Length = 128 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVSEAEIRRAQKAER+ATDLKG+MRKRMEFLD+D Sbjct: 88 ELPPHMTRVSEAEIRRAQKAEREATDLKGTMRKRMEFLDLD 128 >ref|XP_006357408.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Solanum tuberosum] Length = 128 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRV EAEIRRAQKAER+ATDLKG+MRKRMEFLDMD Sbjct: 88 ELPPHMTRVPEAEIRRAQKAEREATDLKGTMRKRMEFLDMD 128 >ref|XP_004241918.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Solanum lycopersicum] Length = 128 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRV EAEIRRAQKAER+ATDLKG+MRKRMEFLDMD Sbjct: 88 ELPPHMTRVPEAEIRRAQKAEREATDLKGTMRKRMEFLDMD 128 >ref|XP_002532727.1| lsm1, putative [Ricinus communis] gi|223527535|gb|EEF29658.1| lsm1, putative [Ricinus communis] Length = 128 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVS AEIRRAQKAERDATDLKG+MRKRMEFLD+D Sbjct: 88 ELPPHMTRVSAAEIRRAQKAERDATDLKGTMRKRMEFLDLD 128 >ref|XP_002304120.1| small nuclear ribonucleoprotein [Populus trichocarpa] gi|222841552|gb|EEE79099.1| small nuclear ribonucleoprotein [Populus trichocarpa] Length = 128 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVSEAEI+RAQKAER+ATDLKG+MRKRMEFLD+D Sbjct: 88 ELPPHMTRVSEAEIKRAQKAEREATDLKGTMRKRMEFLDLD 128 >ref|XP_003633086.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Vitis vinifera] gi|297738539|emb|CBI27784.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRV EAEI+RAQKAER+ATDLKGSMRKRMEFLD D Sbjct: 88 ELPPHMTRVPEAEIKRAQKAEREATDLKGSMRKRMEFLDFD 128 >gb|EXC32300.1| Nucleoside diphosphate kinase 6 [Morus notabilis] Length = 468 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVS AEI+RAQKAER+ATDLKG+MRKRMEFLD+D Sbjct: 428 ELPPHMTRVSAAEIKRAQKAEREATDLKGTMRKRMEFLDLD 468 >ref|XP_004303709.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Fragaria vesca subsp. vesca] Length = 128 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVS AEI+RAQKAER+A+DLKG+MRKRMEFLDMD Sbjct: 88 ELPPHMTRVSPAEIKRAQKAEREASDLKGTMRKRMEFLDMD 128 >gb|EMJ04688.1| hypothetical protein PRUPE_ppa022434mg, partial [Prunus persica] Length = 160 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMT V EAEI+RAQKAERDATDLKGSMRKRMEFLD D Sbjct: 120 ELPPHMTLVPEAEIKRAQKAERDATDLKGSMRKRMEFLDFD 160 >ref|XP_002271476.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1 [Vitis vinifera] gi|147803430|emb|CAN62239.1| hypothetical protein VITISV_033727 [Vitis vinifera] gi|297742980|emb|CBI35847.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVS AEI+RAQKAER+A+DLKG+MRKRMEFLD+D Sbjct: 88 ELPPHMTRVSAAEIKRAQKAEREASDLKGTMRKRMEFLDLD 128 >ref|XP_004287651.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Fragaria vesca subsp. vesca] Length = 128 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMT V EAEI+RAQKAERDA+DLKGSMRKRMEFLD D Sbjct: 88 ELPPHMTLVPEAEIKRAQKAERDASDLKGSMRKRMEFLDFD 128 >gb|EMJ16349.1| hypothetical protein PRUPE_ppa013348mg [Prunus persica] Length = 128 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRVS AEI+ AQKAER+A+DLKG+MRKRMEFLDMD Sbjct: 88 ELPPHMTRVSAAEIKSAQKAEREASDLKGTMRKRMEFLDMD 128 >gb|AFK42388.1| unknown [Medicago truncatula] Length = 128 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMT VSEA+IR+AQKAERDA+DLKG+MRKRMEFLD D Sbjct: 88 ELPPHMTCVSEADIRKAQKAERDASDLKGTMRKRMEFLDFD 128 >ref|XP_003595339.1| U6 snRNA-associated Sm-like protein LSm1 [Medicago truncatula] gi|355484387|gb|AES65590.1| U6 snRNA-associated Sm-like protein LSm1 [Medicago truncatula] Length = 128 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMT VSEA+IR+AQKAERDA+DLKG+MRKRMEFLD D Sbjct: 88 ELPPHMTCVSEADIRKAQKAERDASDLKGTMRKRMEFLDFD 128 >ref|XP_002516250.1| lsm1, putative [Ricinus communis] gi|223544736|gb|EEF46252.1| lsm1, putative [Ricinus communis] Length = 128 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELP HMT VSEAEI+RAQKAER+ATDLKGSMRKRMEFLD D Sbjct: 88 ELPSHMTCVSEAEIKRAQKAEREATDLKGSMRKRMEFLDFD 128 >ref|XP_006426701.1| hypothetical protein CICLE_v10026767mg [Citrus clementina] gi|568822947|ref|XP_006465886.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like [Citrus sinensis] gi|557528691|gb|ESR39941.1| hypothetical protein CICLE_v10026767mg [Citrus clementina] Length = 128 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPH+T VS AEI+RAQKAER+A+DLKGSMRKRMEFLD+D Sbjct: 88 ELPPHLTHVSVAEIKRAQKAEREASDLKGSMRKRMEFLDLD 128 >ref|XP_006836602.1| hypothetical protein AMTR_s00131p00107350 [Amborella trichopoda] gi|548839141|gb|ERM99455.1| hypothetical protein AMTR_s00131p00107350 [Amborella trichopoda] Length = 128 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELP HMTRVS EI+RAQKAERDA DLKGSMRKRMEFLD+D Sbjct: 88 ELPAHMTRVSAVEIKRAQKAERDAKDLKGSMRKRMEFLDLD 128 >gb|EOY27290.1| Small nuclear ribonucleoprotein family protein isoform 1 [Theobroma cacao] Length = 128 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMT VS AEIRRAQKAER+A DLKG+MRKRMEFLD+D Sbjct: 88 ELPPHMTCVSAAEIRRAQKAEREARDLKGTMRKRMEFLDLD 128 >ref|XP_004510523.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm1-like isoform X1 [Cicer arietinum] Length = 128 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 ELPPHMTRVSEAEIRRAQKAERDATDLKGSMRKRMEFLDMD 125 ELPPHMTRV EI RAQKAERDA+DLKG+MRKRMEFLDMD Sbjct: 88 ELPPHMTRVPTEEILRAQKAERDASDLKGTMRKRMEFLDMD 128