BLASTX nr result
ID: Atropa21_contig00015168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00015168 (631 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242591.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac... 64 4e-08 ref|XP_006343651.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac... 64 5e-08 >ref|XP_004242591.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic-like [Solanum lycopersicum] Length = 371 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 629 GLVKVVVRRPFKGNDSDVLCTEARNVIKDVLIHQG 525 G VKVV+ +P KGNDSDVLC+EARNVIKDVLIHQG Sbjct: 337 GSVKVVIHKPLKGNDSDVLCSEARNVIKDVLIHQG 371 >ref|XP_006343651.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic-like [Solanum tuberosum] Length = 371 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 629 GLVKVVVRRPFKGNDSDVLCTEARNVIKDVLIHQG 525 G VKVV+ +P KGNDSDVLC+EARNVIKDVL+HQG Sbjct: 337 GSVKVVIHKPLKGNDSDVLCSEARNVIKDVLVHQG 371