BLASTX nr result
ID: Atropa21_contig00009503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00009503 (532 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241909.1| PREDICTED: uncharacterized protein LOC101249... 72 1e-10 ref|XP_006357432.1| PREDICTED: uncharacterized protein C23H3.12c... 71 1e-10 >ref|XP_004241909.1| PREDICTED: uncharacterized protein LOC101249930 [Solanum lycopersicum] Length = 276 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 531 LIRSGEANDSLSESTISDICQRFNLNTMDVVKYKHSL 421 LI+SGE+ND LSESTISDICQRFNLNTMDV+KYKHSL Sbjct: 240 LIQSGESNDGLSESTISDICQRFNLNTMDVIKYKHSL 276 >ref|XP_006357432.1| PREDICTED: uncharacterized protein C23H3.12c-like isoform X1 [Solanum tuberosum] Length = 276 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 531 LIRSGEANDSLSESTISDICQRFNLNTMDVVKYKHSL 421 LI+SGE+ND LSEST+SDICQRFNLNTMDV+KYKHSL Sbjct: 240 LIQSGESNDGLSESTVSDICQRFNLNTMDVIKYKHSL 276