BLASTX nr result
ID: Atropa21_contig00009092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00009092 (886 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252083.1| PREDICTED: early nodulin-like protein 1-like... 74 7e-11 >ref|XP_004252083.1| PREDICTED: early nodulin-like protein 1-like [Solanum lycopersicum] Length = 279 Score = 73.9 bits (180), Expect = 7e-11 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = -2 Query: 459 RSQVQIPAEAKALGDFFQFV*VLMDRVAWYLLLVGGSRYPVKLVEVRASWPGHHGYQKK 283 RSQVQIP E + LG FF L+D YLLLVGG RY VKLV+V SWPGHHGY KK Sbjct: 177 RSQVQIPTETRILGGFFPSDLALVD----YLLLVGGGRYLVKLVKVHTSWPGHHGYSKK 231