BLASTX nr result
ID: Atropa21_contig00009001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00009001 (1032 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231448.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_006359637.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-07 ref|XP_006359636.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-07 ref|XP_002534048.1| pentatricopeptide repeat-containing protein,... 57 9e-06 >ref|XP_004231448.1| PREDICTED: pentatricopeptide repeat-containing protein At4g34830, chloroplastic-like [Solanum lycopersicum] Length = 1182 Score = 65.5 bits (158), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 94 AKNWQKALELYEDIKGINLKPTVSMMNALIT 2 AKNWQKALELYEDIKGINLKPTVSMMNALIT Sbjct: 819 AKNWQKALELYEDIKGINLKPTVSMMNALIT 849 >ref|XP_006359637.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 1109 Score = 63.9 bits (154), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 AKNWQKALELYEDIKGINLKPTVSMMNALIT 2 A+NWQKALELYEDIKGINLKPTVSMMNALIT Sbjct: 746 AQNWQKALELYEDIKGINLKPTVSMMNALIT 776 >ref|XP_006359636.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 1140 Score = 63.9 bits (154), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 AKNWQKALELYEDIKGINLKPTVSMMNALIT 2 A+NWQKALELYEDIKGINLKPTVSMMNALIT Sbjct: 777 AQNWQKALELYEDIKGINLKPTVSMMNALIT 807 >ref|XP_002534048.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525928|gb|EEF28334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1129 Score = 57.4 bits (137), Expect = 9e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 94 AKNWQKALELYEDIKGINLKPTVSMMNALIT 2 AKNWQKALELYEDIK I LKPTVS MNAL+T Sbjct: 766 AKNWQKALELYEDIKAIKLKPTVSTMNALMT 796