BLASTX nr result
ID: Atropa21_contig00008323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00008323 (2985 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356603.1| PREDICTED: putative ribonuclease H protein A... 62 2e-06 >ref|XP_006356603.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 885 Score = 61.6 bits (148), Expect = 2e-06 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +1 Query: 19 MVGGFYVDQKLSKFVTHTNLVLLPNKEHVNIFSDLRPISHSNFIYKILFR 168 MV F+ Q+L +F+THTNLVL+P KE V+ F DLRPIS S FI KI+ R Sbjct: 1 MVRAFFCGQELPRFITHTNLVLIPKKEVVDSFGDLRPISLSTFINKIISR 50