BLASTX nr result
ID: Atropa21_contig00007598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00007598 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347799.1| PREDICTED: uncharacterized protein LOC102599... 126 3e-27 ref|XP_004230121.1| PREDICTED: uncharacterized protein LOC101244... 119 5e-25 >ref|XP_006347799.1| PREDICTED: uncharacterized protein LOC102599811 [Solanum tuberosum] Length = 389 Score = 126 bits (316), Expect = 3e-27 Identities = 62/77 (80%), Positives = 65/77 (84%) Frame = -1 Query: 270 AAATFFLESNLKWNPLLYTPNPIQYTRLFHYPKLLTPSRLSKPSKLTVKYFTKNHKNAFF 91 AAA F LESNLKWNPLLYTPNPIQYTRL HY KL TPS+ SKPSKLTVK F+KNHKN F Sbjct: 2 AAAPFLLESNLKWNPLLYTPNPIQYTRLIHYQKL-TPSKFSKPSKLTVKCFSKNHKNVCF 60 Query: 90 NDRNVLEIKNKETPFEI 40 ND N LE+KNKE PFEI Sbjct: 61 NDGNGLEMKNKENPFEI 77 >ref|XP_004230121.1| PREDICTED: uncharacterized protein LOC101244036 [Solanum lycopersicum] Length = 389 Score = 119 bits (297), Expect = 5e-25 Identities = 59/77 (76%), Positives = 62/77 (80%) Frame = -1 Query: 270 AAATFFLESNLKWNPLLYTPNPIQYTRLFHYPKLLTPSRLSKPSKLTVKYFTKNHKNAFF 91 AAA F LESNLKWNPL YTPNPIQ TRL HY KL TPS+ SK SKLTVK F+KNHKN F Sbjct: 2 AAAPFLLESNLKWNPLFYTPNPIQCTRLIHYQKL-TPSKFSKTSKLTVKCFSKNHKNVCF 60 Query: 90 NDRNVLEIKNKETPFEI 40 ND N LE+KNKE PFEI Sbjct: 61 NDGNGLEVKNKENPFEI 77