BLASTX nr result
ID: Atropa21_contig00007496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00007496 (1679 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275423.1| auxin-repressed 12.5 kDa protein-like [Solan... 67 3e-08 ref|XP_004230256.1| PREDICTED: uncharacterized protein LOC101259... 65 7e-08 >ref|NP_001275423.1| auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] gi|76161010|gb|ABA40468.1| Drm3-like protein [Solanum tuberosum] Length = 128 Score = 66.6 bits (161), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 1678 VTRSIMILNPNGSQNRDSHPVSPAGTTPPVSPFAG 1574 VTRSIMI+ P+GSQNRDS PVSPAGTTPPVSPFAG Sbjct: 59 VTRSIMIVKPSGSQNRDSPPVSPAGTTPPVSPFAG 93 >ref|XP_004230256.1| PREDICTED: uncharacterized protein LOC101259198 isoform 1 [Solanum lycopersicum] Length = 128 Score = 65.5 bits (158), Expect = 7e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 1678 VTRSIMILNPNGSQNRDSHPVSPAGTTPPVSPFAG 1574 VTRSIMI+ P+GSQNRDS PVSPAGTTPPVSPF+G Sbjct: 59 VTRSIMIVKPSGSQNRDSPPVSPAGTTPPVSPFSG 93