BLASTX nr result
ID: Atropa21_contig00007495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00007495 (1639 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275423.1| auxin-repressed 12.5 kDa protein-like [Solan... 105 4e-20 ref|XP_004230256.1| PREDICTED: uncharacterized protein LOC101259... 104 1e-19 ref|XP_004230257.1| PREDICTED: uncharacterized protein LOC101259... 91 2e-15 ref|XP_006604803.1| PREDICTED: uncharacterized protein LOC100814... 71 2e-09 ref|XP_006604804.1| PREDICTED: uncharacterized protein LOC100814... 69 6e-09 ref|XP_006577224.1| PREDICTED: uncharacterized protein LOC100805... 69 8e-09 gb|EOY11524.1| Dormancy/auxin associated family protein isoform ... 68 1e-08 gb|EOY11521.1| Drm3-like protein isoform 1 [Theobroma cacao] 68 1e-08 ref|XP_003521684.1| PREDICTED: uncharacterized protein LOC100805... 67 3e-08 ref|XP_002283180.1| PREDICTED: uncharacterized protein LOC100245... 67 3e-08 gb|AAM62421.1|AF515795_1 Drm3 [Pisum sativum] 67 3e-08 ref|XP_003591161.1| Auxin-repressed 12.5 kDa protein [Medicago t... 66 5e-08 gb|EOY11523.1| Dormancy/auxin associated family protein isoform ... 65 7e-08 ref|XP_003591160.1| Auxin-repressed 12.5 kDa protein [Medicago t... 65 7e-08 ref|XP_003626229.1| Drm3 [Medicago truncatula] gi|355501244|gb|A... 65 9e-08 ref|XP_003626228.1| Drm3 [Medicago truncatula] gi|355501243|gb|A... 65 1e-07 gb|AGV54550.1| dormancy/auxin associated protein Drm3 [Phaseolus... 64 1e-07 gb|EOY11522.1| Dormancy/auxin associated family protein isoform ... 64 1e-07 ref|XP_002512449.1| conserved hypothetical protein [Ricinus comm... 64 2e-07 ref|XP_003591159.1| Auxin-repressed 12.5 kDa protein [Medicago t... 64 2e-07 >ref|NP_001275423.1| auxin-repressed 12.5 kDa protein-like [Solanum tuberosum] gi|76161010|gb|ABA40468.1| Drm3-like protein [Solanum tuberosum] Length = 128 Score = 105 bits (263), Expect = 4e-20 Identities = 53/55 (96%), Positives = 53/55 (96%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGT PVSPFAG Sbjct: 39 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTTPPVSPFAG 93 >ref|XP_004230256.1| PREDICTED: uncharacterized protein LOC101259198 isoform 1 [Solanum lycopersicum] Length = 128 Score = 104 bits (260), Expect = 1e-19 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGT PVSPF+G Sbjct: 39 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTTPPVSPFSG 93 >ref|XP_004230257.1| PREDICTED: uncharacterized protein LOC101259198 isoform 2 [Solanum lycopersicum] Length = 118 Score = 90.5 bits (223), Expect = 2e-15 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGT 1340 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAG+ Sbjct: 39 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGS 84 >ref|XP_006604803.1| PREDICTED: uncharacterized protein LOC100814324 isoform X1 [Glycine max] Length = 211 Score = 70.9 bits (172), Expect = 2e-09 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGK 1310 E+E + RS+ +E+SE+A +VTRSIMIVKP G Q+ SPPVSPAG+ TP+SPF+GK Sbjct: 122 ETEGGSVRSYGDESSEEATRVTRSIMIVKPPGYQS-GSPPVSPAGSTTPISPFSGK 176 >ref|XP_006604804.1| PREDICTED: uncharacterized protein LOC100814324 isoform X2 [Glycine max] Length = 207 Score = 68.9 bits (167), Expect = 6e-09 Identities = 34/55 (61%), Positives = 45/55 (81%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 E+E + RS+ +E+SE+A +VTRSIMIVKP G Q+ SPPVSPAG+ TP+SPF+G Sbjct: 122 ETEGGSVRSYGDESSEEATRVTRSIMIVKPPGYQS-GSPPVSPAGSTTPISPFSG 175 >ref|XP_006577224.1| PREDICTED: uncharacterized protein LOC100805572 isoform X2 [Glycine max] Length = 132 Score = 68.6 bits (166), Expect = 8e-09 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGK 1310 E+E + RS+ +E+SE+A +VTRSIMIVKP G Q+ SPPVSPAG+ P+SPF+GK Sbjct: 39 EAEGGSVRSYGDESSEEATRVTRSIMIVKPPGYQS-GSPPVSPAGSTPPISPFSGK 93 >gb|EOY11524.1| Dormancy/auxin associated family protein isoform 4 [Theobroma cacao] Length = 134 Score = 67.8 bits (164), Expect = 1e-08 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 1483 ASESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 A ES+ + RS+ +E SE+ +VTRSIMIVKP G QN SPP+SPAG+ PVSPF+G Sbjct: 37 AKESDGGSVRSYGDETSEEPTRVTRSIMIVKPPGYQN-GSPPISPAGSTPPVSPFSG 92 >gb|EOY11521.1| Drm3-like protein isoform 1 [Theobroma cacao] Length = 125 Score = 67.8 bits (164), Expect = 1e-08 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -1 Query: 1483 ASESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 A ES+ + RS+ +E SE+ +VTRSIMIVKP G QN SPP+SPAG+ PVSPF+G Sbjct: 37 AKESDGGSVRSYGDETSEEPTRVTRSIMIVKPPGYQN-GSPPISPAGSTPPVSPFSG 92 >ref|XP_003521684.1| PREDICTED: uncharacterized protein LOC100805572 isoformX1 [Glycine max] Length = 124 Score = 66.6 bits (161), Expect = 3e-08 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 E+E + RS+ +E+SE+A +VTRSIMIVKP G Q+ SPPVSPAG+ P+SPF+G Sbjct: 39 EAEGGSVRSYGDESSEEATRVTRSIMIVKPPGYQS-GSPPVSPAGSTPPISPFSG 92 >ref|XP_002283180.1| PREDICTED: uncharacterized protein LOC100245909 isoform 1 [Vitis vinifera] gi|296089731|emb|CBI39550.3| unnamed protein product [Vitis vinifera] Length = 126 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/54 (59%), Positives = 44/54 (81%) Frame = -1 Query: 1474 SEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 S+ RS+++++SE+A++VTRSIMI+KP G QN SPPVSPAG+ PVSPF+G Sbjct: 41 SDGGNGRSYSDDSSEEAMRVTRSIMIIKPPGFQN-GSPPVSPAGSTPPVSPFSG 93 >gb|AAM62421.1|AF515795_1 Drm3 [Pisum sativum] Length = 124 Score = 66.6 bits (161), Expect = 3e-08 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 E E + RS+ EE SE A +VTRSIMIVKP G Q+ SPP SPAG+ TPVSPF+G Sbjct: 39 ELEAGSVRSYGEEPSEPATRVTRSIMIVKPPGYQS-GSPPASPAGSVTPVSPFSG 92 >ref|XP_003591161.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|355480209|gb|AES61412.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] Length = 119 Score = 65.9 bits (159), Expect = 5e-08 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -1 Query: 1456 RSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGKL 1307 RS++ ++ EDA+KVTRSIMI+KP+G Q+ S P SPAG+ PVSPF+GK+ Sbjct: 47 RSYSGDSPEDAMKVTRSIMIMKPAGYQSNGSAPASPAGSTPPVSPFSGKV 96 >gb|EOY11523.1| Dormancy/auxin associated family protein isoform 3 [Theobroma cacao] Length = 107 Score = 65.5 bits (158), Expect = 7e-08 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -1 Query: 1483 ASESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFA 1316 A ES+ + RS+ +E SE+ +VTRSIMIVKP G QN SPP+SPAG+ PVSPF+ Sbjct: 37 AKESDGGSVRSYGDETSEEPTRVTRSIMIVKPPGYQN-GSPPISPAGSTPPVSPFS 91 >ref|XP_003591160.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|217071010|gb|ACJ83865.1| unknown [Medicago truncatula] gi|355480208|gb|AES61411.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|388521433|gb|AFK48778.1| unknown [Medicago truncatula] Length = 132 Score = 65.5 bits (158), Expect = 7e-08 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -1 Query: 1456 RSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGK 1310 RS++ ++ EDA+KVTRSIMI+KP+G Q+ S P SPAG+ PVSPF+GK Sbjct: 47 RSYSGDSPEDAMKVTRSIMIMKPAGYQSNGSAPASPAGSTPPVSPFSGK 95 >ref|XP_003626229.1| Drm3 [Medicago truncatula] gi|355501244|gb|AES82447.1| Drm3 [Medicago truncatula] Length = 104 Score = 65.1 bits (157), Expect = 9e-08 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGKL 1307 E+E + RS+ EE+SE +VTRSIMIVKP G ++ SP SPAG+ TPVSPF+GK+ Sbjct: 39 ETEAGSVRSYGEESSEQTTRVTRSIMIVKPPGYES-GSPLASPAGSTTPVSPFSGKV 94 >ref|XP_003626228.1| Drm3 [Medicago truncatula] gi|355501243|gb|AES82446.1| Drm3 [Medicago truncatula] Length = 128 Score = 64.7 bits (156), Expect = 1e-07 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAGK 1310 E+E + RS+ EE+SE +VTRSIMIVKP G ++ SP SPAG+ TPVSPF+GK Sbjct: 39 ETEAGSVRSYGEESSEQTTRVTRSIMIVKPPGYES-GSPLASPAGSTTPVSPFSGK 93 >gb|AGV54550.1| dormancy/auxin associated protein Drm3 [Phaseolus vulgaris] Length = 131 Score = 64.3 bits (155), Expect = 1e-07 Identities = 32/57 (56%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRD-SPPVSPAGTPTPVSPFAGK 1310 ES+ + +S+ E+++EDA++VTRSIMIVKP G Q++ S P SPAG+ PVSPF+GK Sbjct: 39 ESDGGSLKSYGEDSAEDAMRVTRSIMIVKPPGYQSQSGSAPASPAGSTPPVSPFSGK 95 >gb|EOY11522.1| Dormancy/auxin associated family protein isoform 2 [Theobroma cacao] Length = 124 Score = 64.3 bits (155), Expect = 1e-07 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -1 Query: 1483 ASESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 +++++ + RS+ +E SE+ +VTRSIMIVKP G QN SPP+SPAG+ PVSPF+G Sbjct: 36 SAKADGGSVRSYGDETSEEPTRVTRSIMIVKPPGYQN-GSPPISPAGSTPPVSPFSG 91 >ref|XP_002512449.1| conserved hypothetical protein [Ricinus communis] gi|223548410|gb|EEF49901.1| conserved hypothetical protein [Ricinus communis] Length = 125 Score = 63.5 bits (153), Expect = 2e-07 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = -1 Query: 1477 ESEVSTPRSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 ES+ RS ++ASE+ KVTRSIMIVKP G Q SPPVSPAG+ PVSPF+G Sbjct: 39 ESDGQNGRSLGDDASEEVTKVTRSIMIVKPPGYQ-FGSPPVSPAGSTPPVSPFSG 92 >ref|XP_003591159.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|355480207|gb|AES61410.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|388494480|gb|AFK35306.1| unknown [Medicago truncatula] Length = 128 Score = 63.5 bits (153), Expect = 2e-07 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -1 Query: 1456 RSFTEEASEDAVKVTRSIMIVKPSGSQNRDSPPVSPAGTPTPVSPFAG 1313 RS++ ++ EDA+KVTRSIMI+KP+G Q+ S P SPAG+ PVSPF+G Sbjct: 47 RSYSGDSPEDAMKVTRSIMIMKPAGYQSNGSAPASPAGSTPPVSPFSG 94