BLASTX nr result
ID: Atropa21_contig00005220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00005220 (1263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242228.1| PREDICTED: uncharacterized protein LOC101251... 63 3e-07 ref|XP_006353710.1| PREDICTED: uncharacterized protein LOC102594... 60 2e-06 >ref|XP_004242228.1| PREDICTED: uncharacterized protein LOC101251595 [Solanum lycopersicum] Length = 414 Score = 62.8 bits (151), Expect = 3e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 260 GVSDSEIHNLNLNLKESNSAGRLTKLLSTTKNGIKF 153 G SDSEIHNLN+NLK+SNSAGRLTKL ST KNG KF Sbjct: 55 GTSDSEIHNLNVNLKDSNSAGRLTKLPSTAKNGAKF 90 >ref|XP_006353710.1| PREDICTED: uncharacterized protein LOC102594585 [Solanum tuberosum] Length = 493 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 272 MKVAGVSDSEIHNLNLNLKESNSAGRLTKLLSTTKNGIKF 153 + +SDSEI+NLN+NLK+SNSAGRLTKL ST KNG KF Sbjct: 102 LATTSISDSEIYNLNVNLKDSNSAGRLTKLPSTAKNGAKF 141