BLASTX nr result
ID: Atropa21_contig00003339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00003339 (508 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319791.1| predicted protein [Populus trichocarpa] gi|5... 56 6e-06 >ref|XP_002319791.1| predicted protein [Populus trichocarpa] gi|566154712|ref|XP_006370578.1| ethylene-responsive family protein [Populus trichocarpa] gi|550349784|gb|ERP67147.1| ethylene-responsive family protein [Populus trichocarpa] Length = 444 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +2 Query: 257 SAAYGSSPSNMMQGVYPPYNQSNYPQFLRSSPPNQQP--QLQFSYNNTPFWNGTAAAMND 430 S AYG++ S + P + + PQFLR+SPP Q QL FS NNTPFWN +A+AMND Sbjct: 224 SYAYGANYSLGTNELLPSWPKG--PQFLRNSPPKQTSSNQLHFS-NNTPFWNASASAMND 280 Query: 431 VR 436 VR Sbjct: 281 VR 282