BLASTX nr result
ID: Atropa21_contig00002039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00002039 (955 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230309.1| PREDICTED: ATP-dependent Clp protease proteo... 83 2e-13 ref|XP_006344766.1| PREDICTED: ATP-dependent Clp protease proteo... 78 6e-12 >ref|XP_004230309.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic [Solanum lycopersicum] gi|15485610|emb|CAC67407.1| Clp protease 2 proteolytic subunit [Solanum lycopersicum] Length = 299 Score = 82.8 bits (203), Expect = 2e-13 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = +1 Query: 124 MAHS--SXTSSISKLNCPIFPSDSCTLSQAHPVSLPFKPLSFRKLKSVGKVKNRVNTTVK 297 MAHS + TSS+SK N IFPSD C +S P+SL FK LS RK+K+VGKVK+R N+TVK Sbjct: 1 MAHSCIATTSSLSKYNSAIFPSDYCNIS---PISLQFKRLSLRKVKAVGKVKSRGNSTVK 57 Query: 298 AVYSGAADWD--SGTSRSEIWS 357 AVYSG DWD + S IWS Sbjct: 58 AVYSG-GDWDLAKASRSSGIWS 78 >ref|XP_006344766.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic-like [Solanum tuberosum] Length = 295 Score = 77.8 bits (190), Expect = 6e-12 Identities = 50/82 (60%), Positives = 55/82 (67%), Gaps = 4/82 (4%) Frame = +1 Query: 124 MAHS--SXTSSISKLNCPIFPSDSCTLSQAHPVSLPFKPLSFRKLKSVGKVKNRVNTTVK 297 MAHS + TSS+SK N IFPSDSC LS P+SL FK LS R GKVKNR N+TVK Sbjct: 1 MAHSCIATTSSLSKFNSSIFPSDSCNLS---PISLQFKRLSLRN----GKVKNRGNSTVK 53 Query: 298 AVYSGAADWD--SGTSRSEIWS 357 AVYSG ADWD + S IWS Sbjct: 54 AVYSG-ADWDLAKASRSSGIWS 74