BLASTX nr result
ID: Atropa21_contig00001068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atropa21_contig00001068 (814 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349106.1| PREDICTED: peptidylprolyl isomerase domain a... 72 2e-10 ref|XP_004251035.1| PREDICTED: peptidylprolyl isomerase domain a... 72 2e-10 ref|XP_002529071.1| WD-repeat protein, putative [Ricinus communi... 69 2e-09 ref|XP_006851547.1| hypothetical protein AMTR_s00040p00179700 [A... 68 3e-09 ref|XP_006471378.1| PREDICTED: peptidylprolyl isomerase domain a... 68 4e-09 ref|XP_006424299.1| hypothetical protein CICLE_v10028028mg [Citr... 68 4e-09 ref|XP_004487517.1| PREDICTED: peptidylprolyl isomerase domain a... 67 6e-09 gb|EXB53713.1| Peptidylprolyl isomerase domain and WD repeat-con... 67 7e-09 ref|XP_006660381.1| PREDICTED: peptidylprolyl isomerase domain a... 67 1e-08 ref|XP_006419120.1| hypothetical protein EUTSA_v10002440mg [Eutr... 67 1e-08 ref|XP_004974190.1| PREDICTED: peptidylprolyl isomerase domain a... 67 1e-08 gb|EOY33506.1| Cyclophilin71 isoform 2 [Theobroma cacao] 67 1e-08 gb|EOY33505.1| Peptidylprolyl isomerase domain and WD repeat-con... 67 1e-08 gb|EMT04136.1| Peptidylprolyl isomerase domain and WD repeat-con... 67 1e-08 gb|EMS50441.1| Peptidylprolyl isomerase domain and WD repeat-con... 67 1e-08 dbj|BAD09085.1| putative cyclophilin (70.8 kD) (cyp-15) [Oryza s... 67 1e-08 gb|AFW61738.1| putative peptidyl-prolyl cis-trans isomerase and ... 67 1e-08 gb|AFW61737.1| putative peptidyl-prolyl cis-trans isomerase and ... 67 1e-08 ref|XP_002269959.2| PREDICTED: peptidylprolyl isomerase domain a... 67 1e-08 ref|XP_003574923.1| PREDICTED: peptidylprolyl isomerase domain a... 67 1e-08 >ref|XP_006349106.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Solanum tuberosum] Length = 621 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS Sbjct: 587 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 621 >ref|XP_004251035.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Solanum lycopersicum] Length = 622 Score = 72.4 bits (176), Expect = 2e-10 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS Sbjct: 588 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 622 >ref|XP_002529071.1| WD-repeat protein, putative [Ricinus communis] gi|223531483|gb|EEF33315.1| WD-repeat protein, putative [Ricinus communis] Length = 623 Score = 69.3 bits (168), Expect = 2e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQS+EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 589 VKGMDVVQSIEKVKTDKADKPYQDVKILNVTVPKS 623 >ref|XP_006851547.1| hypothetical protein AMTR_s00040p00179700 [Amborella trichopoda] gi|548855241|gb|ERN13128.1| hypothetical protein AMTR_s00040p00179700 [Amborella trichopoda] Length = 622 Score = 68.2 bits (165), Expect = 3e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ++EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 588 VKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS 622 >ref|XP_006471378.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like isoform X1 [Citrus sinensis] Length = 623 Score = 67.8 bits (164), Expect = 4e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 +KGMDVVQ++EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 589 IKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS 623 >ref|XP_006424299.1| hypothetical protein CICLE_v10028028mg [Citrus clementina] gi|567863292|ref|XP_006424300.1| hypothetical protein CICLE_v10028028mg [Citrus clementina] gi|557526233|gb|ESR37539.1| hypothetical protein CICLE_v10028028mg [Citrus clementina] gi|557526234|gb|ESR37540.1| hypothetical protein CICLE_v10028028mg [Citrus clementina] Length = 623 Score = 67.8 bits (164), Expect = 4e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 +KGMDVVQ++EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 589 IKGMDVVQAIEKVKTDKNDKPYQDVKILNVTVPKS 623 >ref|XP_004487517.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like isoform X2 [Cicer arietinum] Length = 615 Score = 67.4 bits (163), Expect = 6e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ++EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 581 VKGMDVVQAIEKVKTDKTDKPYQDVKILNVTVPKS 615 >gb|EXB53713.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Morus notabilis] Length = 618 Score = 67.0 bits (162), Expect = 7e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 +KGMDVVQ++EKVKTDK DKPYQDVKILNVTVPKS Sbjct: 584 IKGMDVVQAIEKVKTDKTDKPYQDVKILNVTVPKS 618 >ref|XP_006660381.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Oryza brachyantha] Length = 620 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 586 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 620 >ref|XP_006419120.1| hypothetical protein EUTSA_v10002440mg [Eutrema salsugineum] gi|557097048|gb|ESQ37556.1| hypothetical protein EUTSA_v10002440mg [Eutrema salsugineum] Length = 631 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK D+PYQDVKILNVTVPKS Sbjct: 597 VKGMDVVQGIEKVKTDKNDRPYQDVKILNVTVPKS 631 >ref|XP_004974190.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1-like [Setaria italica] Length = 648 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 614 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 648 >gb|EOY33506.1| Cyclophilin71 isoform 2 [Theobroma cacao] Length = 620 Score = 66.6 bits (161), Expect = 1e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 +KGMDVVQ++EKVKTDK D+PYQDVKILNVTVPKS Sbjct: 586 IKGMDVVQAIEKVKTDKADRPYQDVKILNVTVPKS 620 >gb|EOY33505.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1 isoform 1 [Theobroma cacao] Length = 687 Score = 66.6 bits (161), Expect = 1e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 +KGMDVVQ++EKVKTDK D+PYQDVKILNVTVPKS Sbjct: 653 IKGMDVVQAIEKVKTDKADRPYQDVKILNVTVPKS 687 >gb|EMT04136.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Aegilops tauschii] Length = 644 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 610 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 644 >gb|EMS50441.1| Peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Triticum urartu] Length = 648 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 614 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 648 >dbj|BAD09085.1| putative cyclophilin (70.8 kD) (cyp-15) [Oryza sativa Japonica Group] Length = 423 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 389 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 423 >gb|AFW61738.1| putative peptidyl-prolyl cis-trans isomerase and WD40 repeat domain family protein isoform 1 [Zea mays] gi|413921807|gb|AFW61739.1| putative peptidyl-prolyl cis-trans isomerase and WD40 repeat domain family protein isoform 2 [Zea mays] Length = 615 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 581 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 615 >gb|AFW61737.1| putative peptidyl-prolyl cis-trans isomerase and WD40 repeat domain family protein [Zea mays] Length = 485 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 451 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 485 >ref|XP_002269959.2| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Vitis vinifera] Length = 548 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 514 VKGMDVVQGIEKVKTDKADKPYQDVKILNVTVPKA 548 >ref|XP_003574923.1| PREDICTED: peptidylprolyl isomerase domain and WD repeat-containing protein 1 [Brachypodium distachyon] Length = 652 Score = 66.6 bits (161), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKS 107 VKGMDVVQ +EKVKTDK DKPYQDVKILNVTVPK+ Sbjct: 618 VKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT 652