BLASTX nr result
ID: Atractylodes22_contig00057278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00057278 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsi... 59 4e-07 gb|AAC33963.1| contains similarity to reverse transcriptases (Pf... 57 2e-06 emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera] 56 3e-06 emb|CAB10526.1| retrotransposon like protein [Arabidopsis thalia... 56 3e-06 emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera] 55 6e-06 >gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1333 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/53 (47%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +2 Query: 83 RPLLFRSNVPIMTWTDCLLTVNYLVNRTP-RLFGDISPYEKLHKRPPYYYYMR 238 R L F++N+PI W +C+LT YL+NRTP + D +PYE+LHK+ P + ++R Sbjct: 561 RALRFQANLPIQFWGECVLTAAYLINRTPSSVLNDSTPYERLHKKQPRFDHLR 613 >gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, score: 11.19) [Arabidopsis thaliana] Length = 1633 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = +2 Query: 23 CAYGKCECEGVKKKNSYFQT--RPLLFRSNVPIMTWTDCLLTVNYLVNRTPR-LFGDISP 193 CAY + V++K+ + R LLF+SNVP+ W+DC+LT YL+NR P L + +P Sbjct: 647 CAYTPQQNSVVERKHQHLLNIARSLLFQSNVPLQYWSDCVLTAAYLINRLPSPLLDNKTP 706 Query: 194 YEKLHKRPPYYYYMRT 241 +E L K+ P Y +++ Sbjct: 707 FELLLKKIPDYTLLKS 722 >emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera] Length = 1262 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +2 Query: 83 RPLLFRSNVPIMTWTDCLLTVNYLVNRTP-RLFGDISPYEKLHKRPPYYYYMR 238 R L+F+S +P+ WTDC+LT +L+NRTP + + +PY+ L ++PP Y Y + Sbjct: 676 RSLMFQSKLPLSYWTDCVLTXTHLINRTPSSILNNQTPYQLLFQKPPNYNYFK 728 >emb|CAB10526.1| retrotransposon like protein [Arabidopsis thaliana] gi|7268497|emb|CAB78748.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1433 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +2 Query: 83 RPLLFRSNVPIMTWTDCLLTVNYLVNRTPR-LFGDISPYEKLHKRPPYYYYMRT 241 R LLF+SN+P+ W DC+LT +L+NR P + + SPYEKL PP Y ++T Sbjct: 713 RALLFQSNIPLEFWGDCVLTAVFLINRLPTPVLNNKSPYEKLKNIPPAYESLKT 766 >emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera] Length = 1288 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/53 (47%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +2 Query: 83 RPLLFRSNVPIMTWTDCLLTVNYLVNRTPRLF-GDISPYEKLHKRPPYYYYMR 238 R LLF S++P+ W+DC+LT YL+NRTP F + +P+E LH + P Y ++R Sbjct: 583 RALLFXSSLPVCYWSDCILTAVYLINRTPSPFLNNKTPFEILHDKLPDYSHLR 635