BLASTX nr result
ID: Atractylodes22_contig00057276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00057276 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545226.1| PREDICTED: omega-hydroxypalmitate O-feruloyl... 60 2e-07 ref|XP_003600946.1| Taxadien-5-alpha-ol O-acetyltransferase [Med... 60 2e-07 ref|XP_003518437.1| PREDICTED: taxadien-5-alpha-ol O-acetyltrans... 60 2e-07 ref|NP_181552.1| HXXXD-type acyl-transferase-like protein [Arabi... 58 9e-07 ref|XP_002881703.1| transferase family protein [Arabidopsis lyra... 57 1e-06 >ref|XP_003545226.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like [Glycine max] Length = 441 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 111 GSDVQVKEAVFITPSDPTPSHVLKLSAIDSQLFLRFTI 224 GS V+VKEA ITPS+PTPS VL LSA+DSQLFLRFTI Sbjct: 2 GSSVRVKEASVITPSEPTPSSVLALSALDSQLFLRFTI 39 >ref|XP_003600946.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula] gi|355489994|gb|AES71197.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula] Length = 434 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 111 GSDVQVKEAVFITPSDPTPSHVLKLSAIDSQLFLRFTI 224 GS V+VKEAV +TPS+PTP+ VL LSA+DSQLFLRFT+ Sbjct: 2 GSSVRVKEAVVVTPSEPTPNCVLSLSALDSQLFLRFTV 39 >ref|XP_003518437.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Glycine max] Length = 440 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 111 GSDVQVKEAVFITPSDPTPSHVLKLSAIDSQLFLRFTI 224 GS V+VKEA +TPS+PTPS VL LSA+DSQLFLRFTI Sbjct: 2 GSSVRVKEASVVTPSEPTPSSVLALSALDSQLFLRFTI 39 >ref|NP_181552.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] gi|4587997|gb|AAD25938.1|AF085279_11 hypothetical protein [Arabidopsis thaliana] gi|21536614|gb|AAM60946.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis thaliana] gi|330254705|gb|AEC09799.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana] Length = 433 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 111 GSDVQVKEAVFITPSDPTPSHVLKLSAIDSQLFLRFTI 224 GS V VKEA ITPSD TPS VL LSA+DSQLFLRFTI Sbjct: 2 GSLVHVKEATVITPSDQTPSSVLSLSALDSQLFLRFTI 39 >ref|XP_002881703.1| transferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327542|gb|EFH57962.1| transferase family protein [Arabidopsis lyrata subsp. lyrata] Length = 433 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 111 GSDVQVKEAVFITPSDPTPSHVLKLSAIDSQLFLRFTI 224 GS V VKEA ITPSD TPS VL LSA+DSQLFLRFTI Sbjct: 2 GSLVHVKEATVITPSDQTPSSVLPLSALDSQLFLRFTI 39