BLASTX nr result
ID: Atractylodes22_contig00057153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00057153 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82937.1| hypothetical protein VITISV_039222 [Vitis vinifera] 106 2e-21 emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] 105 4e-21 emb|CAN82928.1| hypothetical protein VITISV_025045 [Vitis vinifera] 105 5e-21 emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera] 105 5e-21 emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] 105 5e-21 >emb|CAN82937.1| hypothetical protein VITISV_039222 [Vitis vinifera] Length = 1193 Score = 106 bits (264), Expect = 2e-21 Identities = 45/76 (59%), Positives = 61/76 (80%) Frame = +2 Query: 5 YLMNRMPSKVLKFQTPLQVLLQTYPDTHLFTADFQTRVFGCVSYVHIHNHNRSKFDPRAI 184 YL+NRMPS+VL FQ+P Q+ L+ +P TH ++D +VFGC ++VH+++ NRSKF PRA Sbjct: 751 YLINRMPSRVLTFQSPRQLFLKQFPHTHAASSDLPLKVFGCTAFVHVYSQNRSKFAPRAN 810 Query: 185 KCVFLGYSFTKKGYKC 232 KC+FLGYS T+KGYKC Sbjct: 811 KCIFLGYSPTQKGYKC 826 >emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] Length = 1162 Score = 105 bits (262), Expect = 4e-21 Identities = 45/76 (59%), Positives = 61/76 (80%) Frame = +2 Query: 5 YLMNRMPSKVLKFQTPLQVLLQTYPDTHLFTADFQTRVFGCVSYVHIHNHNRSKFDPRAI 184 YL+NRMPS++L FQTP Q+LLQ++P+T L + +VFGC ++VH+H +R K DPRA+ Sbjct: 383 YLINRMPSRILDFQTPCQILLQSFPNTRLIST-IPFKVFGCSAFVHVHQQHRDKLDPRAL 441 Query: 185 KCVFLGYSFTKKGYKC 232 KC+FLGYS T+KGYKC Sbjct: 442 KCIFLGYSPTQKGYKC 457 >emb|CAN82928.1| hypothetical protein VITISV_025045 [Vitis vinifera] Length = 1468 Score = 105 bits (261), Expect = 5e-21 Identities = 45/76 (59%), Positives = 60/76 (78%) Frame = +2 Query: 5 YLMNRMPSKVLKFQTPLQVLLQTYPDTHLFTADFQTRVFGCVSYVHIHNHNRSKFDPRAI 184 YL+NRMPS+VL FQ+P Q+ L+ +P TH ++D +VFGC ++VH++ NRSKF PRA Sbjct: 696 YLINRMPSRVLTFQSPRQLFLKQFPHTHAASSDLPLKVFGCTAFVHVYPQNRSKFAPRAN 755 Query: 185 KCVFLGYSFTKKGYKC 232 KC+FLGYS T+KGYKC Sbjct: 756 KCIFLGYSPTQKGYKC 771 >emb|CAN78598.1| hypothetical protein VITISV_001332 [Vitis vinifera] Length = 1701 Score = 105 bits (261), Expect = 5e-21 Identities = 45/76 (59%), Positives = 60/76 (78%) Frame = +2 Query: 5 YLMNRMPSKVLKFQTPLQVLLQTYPDTHLFTADFQTRVFGCVSYVHIHNHNRSKFDPRAI 184 YL+NRMPS+VL FQ+P Q+ L+ +P TH ++D +VFGC ++VH++ NRSKF PRA Sbjct: 943 YLINRMPSRVLTFQSPRQLFLKQFPHTHAASSDLPLKVFGCTAFVHVYPQNRSKFAPRAN 1002 Query: 185 KCVFLGYSFTKKGYKC 232 KC+FLGYS T+KGYKC Sbjct: 1003 KCIFLGYSPTQKGYKC 1018 >emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] Length = 960 Score = 105 bits (261), Expect = 5e-21 Identities = 45/77 (58%), Positives = 62/77 (80%) Frame = +2 Query: 2 AYLMNRMPSKVLKFQTPLQVLLQTYPDTHLFTADFQTRVFGCVSYVHIHNHNRSKFDPRA 181 AYL+NRM S++L FQTP Q+LLQ++P+THL + +VFGC+++VH+H +R K DPRA Sbjct: 209 AYLINRMSSRILDFQTPCQILLQSFPNTHLIST-IPFKVFGCLAFVHVHQQHRDKLDPRA 267 Query: 182 IKCVFLGYSFTKKGYKC 232 +KC+FL YS T+KGYKC Sbjct: 268 LKCIFLWYSPTQKGYKC 284