BLASTX nr result
ID: Atractylodes22_contig00056831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056831 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635044.1| PREDICTED: calcium-activated outward-rectify... 86 2e-15 ref|XP_003635043.1| PREDICTED: calcium-activated outward-rectify... 86 2e-15 gb|AAF97863.1| outward-rectifying potassium channel KCO1 [Eucaly... 85 7e-15 emb|CAA65988.1| outward rectifying potassium channel KCO1 [Arabi... 83 2e-14 ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectify... 83 3e-14 >ref|XP_003635044.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like [Vitis vinifera] gi|297736715|emb|CBI25751.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 86.3 bits (212), Expect = 2e-15 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -1 Query: 212 GRLFAVFWILMSTISLAQLFVYLVELWTENRQRRLVDWVLRRKLTIQDIEKADLDNDKSV 33 GR FAVFWIL STI LAQ F+YL EL+TE RQR LV WVL RK+T D+E ADLD+D++V Sbjct: 240 GRAFAVFWILSSTICLAQFFLYLAELYTEGRQRSLVKWVLTRKMTFSDLEGADLDHDQAV 299 >ref|XP_003635043.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like [Vitis vinifera] gi|297736711|emb|CBI25747.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 86.3 bits (212), Expect = 2e-15 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -1 Query: 212 GRLFAVFWILMSTISLAQLFVYLVELWTENRQRRLVDWVLRRKLTIQDIEKADLDNDKSV 33 GR FAVFWIL STI LAQ F+YL EL+TE RQR LV WVL RK+T D+E ADLD+D++V Sbjct: 240 GRAFAVFWILSSTICLAQFFLYLAELYTEGRQRSLVKWVLTRKMTFSDLEGADLDHDQAV 299 >gb|AAF97863.1| outward-rectifying potassium channel KCO1 [Eucalyptus camaldulensis] Length = 348 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = -1 Query: 218 EGGRLFAVFWILMSTISLAQLFVYLVELWTENRQRRLVDWVLRRKLTIQDIEKADLDND 42 EGGR+FAVFWIL STI LAQ F+Y+ EL TENRQR LV WV R++T D+E ADLDND Sbjct: 237 EGGRIFAVFWILTSTICLAQFFLYIAELNTENRQRALVKWVPSRRMTNFDLEAADLDND 295 >emb|CAA65988.1| outward rectifying potassium channel KCO1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158.1| kco1 [Arabidopsis thaliana] Length = 363 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -1 Query: 218 EGGRLFAVFWILMSTISLAQLFVYLVELWTENRQRRLVDWVLRRKLTIQDIEKADLDND 42 E GRLFAVFWIL STI LAQ F+Y+ EL TEN+QR LV WVL R++T D+E ADLD D Sbjct: 247 EAGRLFAVFWILTSTICLAQFFLYVAELNTENKQRALVKWVLTRRITNNDLEAADLDED 305 >ref|XP_003544656.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 1 [Glycine max] gi|356552609|ref|XP_003544657.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1-like isoform 2 [Glycine max] Length = 348 Score = 82.8 bits (203), Expect = 3e-14 Identities = 42/72 (58%), Positives = 53/72 (73%) Frame = -1 Query: 218 EGGRLFAVFWILMSTISLAQLFVYLVELWTENRQRRLVDWVLRRKLTIQDIEKADLDNDK 39 + GR+FAVFWIL TI+LAQLF+Y+ EL TE RQ+ LV WVL RK+T D+E ADLD D Sbjct: 237 QAGRIFAVFWILTGTITLAQLFLYIAELNTEIRQKELVKWVLTRKVTNSDLEAADLDVDG 296 Query: 38 SVR*SCIVLVNL 3 +VR + V+ L Sbjct: 297 TVRAAEFVIYKL 308