BLASTX nr result
ID: Atractylodes22_contig00056828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056828 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV42261.1| hypothetical protein [Beta vulgaris] 139 4e-40 ref|XP_002450635.1| hypothetical protein SORBIDRAFT_05g008466 [S... 143 1e-39 ref|XP_002443132.1| hypothetical protein SORBIDRAFT_08g010830 [S... 142 1e-39 gb|ACY01928.1| hypothetical protein [Beta vulgaris] 137 1e-39 ref|XP_002453806.1| hypothetical protein SORBIDRAFT_04g018075 [S... 142 1e-39 >gb|AEV42261.1| hypothetical protein [Beta vulgaris] Length = 1396 Score = 139 bits (351), Expect(2) = 4e-40 Identities = 64/99 (64%), Positives = 80/99 (80%) Frame = +2 Query: 83 SLFFTKLDLKSGYKQIRMRPESVDKTAFRTHDGHYEYLIMPFGLTNAPSTFQAVMNDIFR 262 S F+KLDLKSGY QI M+ E V KTAFRTH+GHYE+L+MPFGLTNAP+TFQAVMND+FR Sbjct: 542 STVFSKLDLKSGYHQILMKKEDVQKTAFRTHEGHYEFLVMPFGLTNAPATFQAVMNDVFR 601 Query: 263 PHLRRFIVVFFDDILVNNATWDQHLLDLSTALDILVHNQ 379 P+LR+F++VFFDDILV + QH+ L L++L N+ Sbjct: 602 PYLRKFVLVFFDDILVYSMGMTQHVEHLKKVLEVLAQNE 640 Score = 50.1 bits (118), Expect(2) = 4e-40 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 3 YRALNKVTVPDKYHIPVVDELIDELTGA 86 YRALN VTVPDKY IPV+DEL+DEL G+ Sbjct: 515 YRALNNVTVPDKYPIPVIDELLDELQGS 542 >ref|XP_002450635.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor] gi|241936478|gb|EES09623.1| hypothetical protein SORBIDRAFT_05g008466 [Sorghum bicolor] Length = 1507 Score = 143 bits (360), Expect(2) = 1e-39 Identities = 66/97 (68%), Positives = 78/97 (80%) Frame = +2 Query: 89 FFTKLDLKSGYKQIRMRPESVDKTAFRTHDGHYEYLIMPFGLTNAPSTFQAVMNDIFRPH 268 FFTKLDL+SGY Q+RMRPE V KTAFRTHDG YE+L+M FGL NAP+TFQA+MND+ RP Sbjct: 675 FFTKLDLRSGYHQVRMRPEDVHKTAFRTHDGLYEFLVMAFGLCNAPATFQALMNDVLRPF 734 Query: 269 LRRFIVVFFDDILVNNATWDQHLLDLSTALDILVHNQ 379 LRRF++VFFDDIL+ + TW HL L LD L H+Q Sbjct: 735 LRRFVLVFFDDILIYSRTWADHLRHLRAVLDELQHHQ 771 Score = 45.4 bits (106), Expect(2) = 1e-39 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 3 YRALNKVTVPDKYHIPVVDELIDELTGAYFLPNL 104 YRALN +TV D + IPVVDEL+DEL GA F L Sbjct: 646 YRALNALTVKDAFPIPVVDELLDELHGAKFFTKL 679 >ref|XP_002443132.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor] gi|241943825|gb|EES16970.1| hypothetical protein SORBIDRAFT_08g010830 [Sorghum bicolor] Length = 1462 Score = 142 bits (357), Expect(2) = 1e-39 Identities = 63/97 (64%), Positives = 78/97 (80%) Frame = +2 Query: 89 FFTKLDLKSGYKQIRMRPESVDKTAFRTHDGHYEYLIMPFGLTNAPSTFQAVMNDIFRPH 268 FFTKLDL+SGY Q+RMR +DKTAFRTHDG YE+L+MPFGL NAP+TFQA+MND+ RP Sbjct: 581 FFTKLDLRSGYHQVRMRASDIDKTAFRTHDGLYEFLVMPFGLCNAPATFQALMNDVLRPF 640 Query: 269 LRRFIVVFFDDILVNNATWDQHLLDLSTALDILVHNQ 379 LRRF++VFFDDIL+ + +W HL L L +L H+Q Sbjct: 641 LRRFVLVFFDDILIYSTSWADHLRHLRAVLTVLQHHQ 677 Score = 46.6 bits (109), Expect(2) = 1e-39 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 3 YRALNKVTVPDKYHIPVVDELIDELTGAYFLPNL 104 YRALN +TV D + IPVVDEL+DEL GA F L Sbjct: 552 YRALNAITVKDAFPIPVVDELLDELRGAKFFTKL 585 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 137 bits (346), Expect(2) = 1e-39 Identities = 60/95 (63%), Positives = 81/95 (85%) Frame = +2 Query: 92 FTKLDLKSGYKQIRMRPESVDKTAFRTHDGHYEYLIMPFGLTNAPSTFQAVMNDIFRPHL 271 F+KLDLKSGY QI+M+P V KTAFRTH+GHYE+L+MPFGLTNAP+TFQA+MN++F+P+L Sbjct: 709 FSKLDLKSGYHQIKMKPSDVHKTAFRTHEGHYEFLVMPFGLTNAPATFQALMNEVFKPYL 768 Query: 272 RRFIVVFFDDILVNNATWDQHLLDLSTALDILVHN 376 R+F++VFFDDILV + + +QH+ L+ L +L N Sbjct: 769 RKFVLVFFDDILVYSTSLEQHMHHLNVVLGLLATN 803 Score = 50.4 bits (119), Expect(2) = 1e-39 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +3 Query: 3 YRALNKVTVPDKYHIPVVDELIDELTGA 86 YRALN VTVPDKY IP++DEL+DEL GA Sbjct: 679 YRALNNVTVPDKYPIPIIDELLDELHGA 706 >ref|XP_002453806.1| hypothetical protein SORBIDRAFT_04g018075 [Sorghum bicolor] gi|241933637|gb|EES06782.1| hypothetical protein SORBIDRAFT_04g018075 [Sorghum bicolor] Length = 1414 Score = 142 bits (359), Expect(2) = 1e-39 Identities = 65/93 (69%), Positives = 77/93 (82%) Frame = +2 Query: 89 FFTKLDLKSGYKQIRMRPESVDKTAFRTHDGHYEYLIMPFGLTNAPSTFQAVMNDIFRPH 268 FFTKLDL+SGY Q+RMRPE V KTAFRTHDG YE+L+MPFGL NAP+TFQA+MND+ R + Sbjct: 555 FFTKLDLRSGYHQVRMRPEDVHKTAFRTHDGLYEFLVMPFGLCNAPATFQALMNDVLRAY 614 Query: 269 LRRFIVVFFDDILVNNATWDQHLLDLSTALDIL 367 LRRF++VFFDDIL+ + TW HL L LDIL Sbjct: 615 LRRFVLVFFDDILIYSTTWADHLRHLRVVLDIL 647 Score = 45.4 bits (106), Expect(2) = 1e-39 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 3 YRALNKVTVPDKYHIPVVDELIDELTGAYFLPNL 104 YRALN +TV D + IPVVDEL+DEL GA F L Sbjct: 526 YRALNALTVKDAFPIPVVDELLDELHGARFFTKL 559