BLASTX nr result
ID: Atractylodes22_contig00056603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056603 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_193221.3| pentatricopeptide repeat-containing protein [Ar... 103 1e-20 gb|AAQ65087.1| At4g14850 [Arabidopsis thaliana] 103 1e-20 ref|XP_002870277.1| hypothetical protein ARALYDRAFT_493409 [Arab... 103 2e-20 ref|XP_002314694.1| predicted protein [Populus trichocarpa] gi|2... 102 3e-20 ref|XP_002517126.1| pentatricopeptide repeat-containing protein,... 96 2e-18 >ref|NP_193221.3| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122236284|sp|Q0WSH6.1|PP312_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14850; AltName: Full=Protein LOVASTATIN INSENSITIVE 1 gi|110735893|dbj|BAE99922.1| hypothetical protein [Arabidopsis thaliana] gi|332658109|gb|AEE83509.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 684 Score = 103 bits (258), Expect = 1e-20 Identities = 46/83 (55%), Positives = 62/83 (74%) Frame = +1 Query: 1 GHPRKAIDAFIKSRRIGGEPSSITFCVVLNACSDAFYSQLGKQVHGFAIRYGYERHVSVA 180 G PR+AI+AFI+ RRI G P+SITFC LNACSD + LG Q+HG +R G++ VSV Sbjct: 188 GRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQLHGLVLRSGFDTDVSVC 247 Query: 181 NGMINFYGKCRDISSARIVFDDI 249 NG+I+FYGKC+ I S+ I+F ++ Sbjct: 248 NGLIDFYGKCKQIRSSEIIFTEM 270 >gb|AAQ65087.1| At4g14850 [Arabidopsis thaliana] Length = 634 Score = 103 bits (258), Expect = 1e-20 Identities = 46/83 (55%), Positives = 62/83 (74%) Frame = +1 Query: 1 GHPRKAIDAFIKSRRIGGEPSSITFCVVLNACSDAFYSQLGKQVHGFAIRYGYERHVSVA 180 G PR+AI+AFI+ RRI G P+SITFC LNACSD + LG Q+HG +R G++ VSV Sbjct: 138 GRPREAIEAFIEFRRIDGHPNSITFCAFLNACSDWLHLNLGMQLHGLVLRSGFDTDVSVC 197 Query: 181 NGMINFYGKCRDISSARIVFDDI 249 NG+I+FYGKC+ I S+ I+F ++ Sbjct: 198 NGLIDFYGKCKQIRSSEIIFTEM 220 >ref|XP_002870277.1| hypothetical protein ARALYDRAFT_493409 [Arabidopsis lyrata subsp. lyrata] gi|297316113|gb|EFH46536.1| hypothetical protein ARALYDRAFT_493409 [Arabidopsis lyrata subsp. lyrata] Length = 684 Score = 103 bits (256), Expect = 2e-20 Identities = 46/83 (55%), Positives = 62/83 (74%) Frame = +1 Query: 1 GHPRKAIDAFIKSRRIGGEPSSITFCVVLNACSDAFYSQLGKQVHGFAIRYGYERHVSVA 180 G P++AI+AFI+ RRIGG+P+SITFC LNACSD LG Q+HG R G++ VSV Sbjct: 188 GRPKEAIEAFIEFRRIGGQPNSITFCGFLNACSDGLLLDLGMQMHGLVFRSGFDTDVSVY 247 Query: 181 NGMINFYGKCRDISSARIVFDDI 249 NG+I+FYGKC+ I S+ I+F ++ Sbjct: 248 NGLIDFYGKCKQIRSSEIIFAEM 270 >ref|XP_002314694.1| predicted protein [Populus trichocarpa] gi|222863734|gb|EEF00865.1| predicted protein [Populus trichocarpa] Length = 631 Score = 102 bits (254), Expect = 3e-20 Identities = 47/81 (58%), Positives = 60/81 (74%) Frame = +1 Query: 1 GHPRKAIDAFIKSRRIGGEPSSITFCVVLNACSDAFYSQLGKQVHGFAIRYGYERHVSVA 180 G P KAID FI+ RR+GGEP ITFC LNAC+DA LG+Q+HG IR G+E VSVA Sbjct: 138 GRPGKAIDKFIEFRRVGGEPDLITFCAFLNACADARCLDLGRQLHGLVIRSGFEGDVSVA 197 Query: 181 NGMINFYGKCRDISSARIVFD 243 NG+I+ YGKC+++ A +VF+ Sbjct: 198 NGIIDVYGKCKEVELAEMVFN 218 >ref|XP_002517126.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543761|gb|EEF45289.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 463 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/80 (53%), Positives = 57/80 (71%) Frame = +1 Query: 1 GHPRKAIDAFIKSRRIGGEPSSITFCVVLNACSDAFYSQLGKQVHGFAIRYGYERHVSVA 180 G + A AF++ RR G EP S TFCV NAC+D Y LG+Q+HGF IR G+E+ VSV Sbjct: 188 GRYQNAAVAFVELRRAGCEPDSTTFCVFFNACADQLYVDLGRQLHGFVIRSGFEKSVSVL 247 Query: 181 NGMINFYGKCRDISSARIVF 240 NG+I+FYGKC+++ A +VF Sbjct: 248 NGLIDFYGKCKEVRLAEMVF 267