BLASTX nr result
ID: Atractylodes22_contig00056437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056437 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002333907.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002339778.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 >ref|XP_002333907.1| predicted protein [Populus trichocarpa] gi|222838895|gb|EEE77246.1| predicted protein [Populus trichocarpa] Length = 392 Score = 67.0 bits (162), Expect = 1e-09 Identities = 36/80 (45%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = -1 Query: 280 VQMYLSFCSVSRAIQLAARVRSKLFDSITVPSDL-DSVTETVGKLKPYMRQLLRRYVPGI 104 V++YLS+ SV R+I+LA R+ + +SI PS + D + + + Y R LL RY P I Sbjct: 82 VKIYLSYFSVCRSIRLAKRLDRSILESIVSPSQVTDQWRDRIIDIVHYSRYLLVRYCPKI 141 Query: 103 GEIPLHQGLRFVPTWKALPS 44 +PL QG+ F PTWKA+PS Sbjct: 142 ESMPLCQGVTFCPTWKAIPS 161 >ref|XP_002339778.1| predicted protein [Populus trichocarpa] gi|222832218|gb|EEE70695.1| predicted protein [Populus trichocarpa] Length = 307 Score = 67.0 bits (162), Expect = 1e-09 Identities = 36/80 (45%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = -1 Query: 280 VQMYLSFCSVSRAIQLAARVRSKLFDSITVPSDL-DSVTETVGKLKPYMRQLLRRYVPGI 104 V++YLS+ SV R+I+LA R+ + +SI PS + D + + + Y R LL RY P I Sbjct: 78 VKIYLSYFSVCRSIRLAKRLDRSILESIVSPSQVTDQWRDRIIDIVHYSRYLLVRYCPKI 137 Query: 103 GEIPLHQGLRFVPTWKALPS 44 +PL QG+ F PTWKA+PS Sbjct: 138 ESMPLCQGVTFCPTWKAIPS 157