BLASTX nr result
ID: Atractylodes22_contig00056343
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056343 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] 59 4e-07 emb|CCH50966.1| T4.5 [Malus x robusta] 55 8e-06 emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] 55 8e-06 >emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] Length = 731 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 252 IFLGYSLSKSAYKCYDPKSHRLFHSRHVQFVDHVFPHKSS 133 IFLGYSL++SAY CYDP + + F SRHV+FV+ +FP KSS Sbjct: 537 IFLGYSLTQSAYFCYDPSTSKNFVSRHVRFVESIFPFKSS 576 >emb|CCH50966.1| T4.5 [Malus x robusta] Length = 1670 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -1 Query: 252 IFLGYSLSKSAYKCYDPKSHRLFHSRHVQFVDHVFPHKS 136 +FLGYSL+ S Y+C+DP S+RL+ SRHV F + +FP+KS Sbjct: 982 VFLGYSLNHSGYRCWDPISNRLYISRHVVFDESLFPYKS 1020 >emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] Length = 1354 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -1 Query: 252 IFLGYSLSKSAYKCYDPKSHRLFHSRHVQFVDHVFPHKS 136 +FLGYSLS+SAY C D + +L+ SRHVQFV+ VFP+ S Sbjct: 689 VFLGYSLSQSAYLCLDXSTSKLYVSRHVQFVESVFPYTS 727