BLASTX nr result
ID: Atractylodes22_contig00056332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056332 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-12 ref|XP_002520332.1| pentatricopeptide repeat-containing protein,... 73 3e-11 ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. l... 72 6e-11 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Vitis vinifera] Length = 432 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/63 (60%), Positives = 51/63 (80%) Frame = +1 Query: 1 VELVDRGSIPREYTYRLVHGMLKSAGKADLLDDELCEKIEDGIRNRYKQVMKVKPVMSAK 180 +ELVD GS+PREYTY++V L+SAG+A++L DEL +IE+GI NRYKQVMKVK +M+ + Sbjct: 370 IELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIMTHR 429 Query: 181 PQL 189 L Sbjct: 430 ISL 432 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/63 (60%), Positives = 51/63 (80%) Frame = +1 Query: 1 VELVDRGSIPREYTYRLVHGMLKSAGKADLLDDELCEKIEDGIRNRYKQVMKVKPVMSAK 180 +ELVD GS+PREYTY++V L+SAG+A++L DEL +IE+GI NRYKQVMKVK +M+ + Sbjct: 319 IELVDGGSVPREYTYKVVCDSLRSAGEANMLGDELRGRIENGIENRYKQVMKVKLIMTHR 378 Query: 181 PQL 189 L Sbjct: 379 ISL 381 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] gi|449518241|ref|XP_004166151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] Length = 445 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = +1 Query: 1 VELVDRGSIPREYTYRLVHGMLKSAGKADLLDDELCEKIEDGIRNRYKQVMKVKPVMSAK 180 +EL++ GS+PREYTY+LV +L SAGKA LLD+ + E+I GI NRY++V KVK +MS K Sbjct: 384 LELLEEGSVPREYTYQLVCNLLNSAGKASLLDENVHERIRHGIENRYREVKKVKLIMSRK 443 >ref|XP_002520332.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540551|gb|EEF42118.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 441 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = +1 Query: 1 VELVDRGSIPREYTYRLVHGMLKSAGKADLLDDELCEKIEDGIRNRYKQVMKVKPVMSAK 180 +ELVD GSIPREYTY+LV +KSA + +L+DDE +I+DGI R++QV KVKP+M K Sbjct: 379 LELVDGGSIPREYTYKLVCETMKSAREVNLIDDEFHNRIKDGIDERFRQVKKVKPIMVRK 438 >ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333522|gb|EFH63940.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 459 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = +1 Query: 1 VELVDRGSIPREYTYRLVHGMLKSAGKADLLDDELCEKIEDGIRNRYKQVMKVKPVMSAK 180 VE+V+ G +PREYTY+LV L S G A LD+EL +++ +GI+ RY++VMK+KPVM+ K Sbjct: 378 VEMVEAGLVPREYTYKLVWDALSSEGMAGTLDEELHKRMREGIQQRYRRVMKIKPVMARK 437 Query: 181 PQLTMGD 201 + D Sbjct: 438 DVVQKSD 444