BLASTX nr result
ID: Atractylodes22_contig00056171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056171 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148188.1| PREDICTED: uncharacterized protein LOC101204... 48 6e-07 >ref|XP_004148188.1| PREDICTED: uncharacterized protein LOC101204314 [Cucumis sativus] Length = 282 Score = 48.1 bits (113), Expect(2) = 6e-07 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 6/96 (6%) Frame = -3 Query: 308 GFSFKARVVDLF-RNGEWSWPLGWLGRYIPFHHL-AIPVSLNSPDRVEWLDIDGKHVTFS 135 G + AR+VD R+G+W WPL +L + + + +S + DR W+ + G H +FS Sbjct: 52 GSRWDARLVDFMGRDGDWRWPLVYLDLMDIWDRVQGVRLSPSVEDR--WVWVPGSHDSFS 109 Query: 134 IRNVWKSLRKQAQEVPWHGF----GSIVSLNTHSLC 39 I + W+++R + V W G G+I HS C Sbjct: 110 ITSAWETIRPHSSRVGWSGLLWGGGNIPK---HSFC 142 Score = 30.0 bits (66), Expect(2) = 6e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 63 IPKHSFIVWLAFHNKLPTQER 1 IPKHSF WLA ++L T+ R Sbjct: 136 IPKHSFCAWLAIRDRLGTRGR 156