BLASTX nr result
ID: Atractylodes22_contig00056048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056048 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528600.1| PREDICTED: pentatricopeptide repeat-containi... 117 1e-24 ref|XP_004140275.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 gb|ABA96976.1| pentatricopeptide, putative, expressed [Oryza sat... 71 8e-11 ref|XP_002441438.1| hypothetical protein SORBIDRAFT_09g026705 [S... 71 8e-11 gb|EEC69079.1| hypothetical protein OsI_37958 [Oryza sativa Indi... 69 3e-10 >ref|XP_003528600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 813 Score = 117 bits (293), Expect = 1e-24 Identities = 56/85 (65%), Positives = 69/85 (81%) Frame = -3 Query: 256 QTHAIALLNGYLPNSISISASLILQYATFGDPSTSRLLFYQSLPYSRSAFLWNTITRAYS 77 Q HA +LL+G+LP S+S+ ASLILQYA+FG PS S LLF S+ YSRSAFLWNT+ RA S Sbjct: 55 QVHAYSLLHGFLPRSVSLCASLILQYASFGHPSNSLLLFQHSVAYSRSAFLWNTLIRANS 114 Query: 76 IAGVYDGFLIYNLMIRSGVRPDDHT 2 IAGV+DGF YN M+R+GV+PD+ T Sbjct: 115 IAGVFDGFGTYNTMVRAGVKPDECT 139 >ref|XP_004140275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 833 Score = 96.7 bits (239), Expect = 2e-18 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 2/87 (2%) Frame = -3 Query: 256 QTHAIALLNGYLPNSISISASLILQYATFGDPSTSRLLFYQSLPYSRSAFLWNTITRAYS 77 Q HA+ +LNG+LP S+S+ ASLIL YA F P + LF Q+ R+AFLWNT+ RA+S Sbjct: 75 QVHALGILNGFLPRSVSLCASLILNYAKFQHPGSFCSLFNQTFQNCRTAFLWNTLIRAHS 134 Query: 76 IA--GVYDGFLIYNLMIRSGVRPDDHT 2 IA G +DGF YN M+R GV+ DDHT Sbjct: 135 IAWNGTFDGFETYNRMVRRGVQLDDHT 161 >gb|ABA96976.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] Length = 780 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/86 (41%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Frame = -3 Query: 256 QTHAIALLNGYLPNSISISASLILQYATFGDPSTSRLLFYQSLPYSRSAFLWNTITRAYS 77 + HA +L++G L S+ ++ +L+L YA D +++RL+ RSAFLWN+++RA S Sbjct: 34 RAHAASLVSGALATSLPLAGALLLSYAALSDLASARLVLRHHPLRLRSAFLWNSLSRALS 93 Query: 76 IAGV-YDGFLIYNLMIRSGVRPDDHT 2 A + + +YNLM+RS VRPDD T Sbjct: 94 SASLPSEALRVYNLMLRSAVRPDDRT 119 >ref|XP_002441438.1| hypothetical protein SORBIDRAFT_09g026705 [Sorghum bicolor] gi|241946723|gb|EES19868.1| hypothetical protein SORBIDRAFT_09g026705 [Sorghum bicolor] Length = 771 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/86 (41%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Frame = -3 Query: 256 QTHAIALLNGYLPNSISISASLILQYATFGDPSTSRLLFYQSLPYSRSAFLWNTITRAYS 77 + HA +L++G L S+ ++ +L+L YA D ++RL+ RSAFLWN+++RA + Sbjct: 23 RAHAASLVSGALTASLPLAGALLLSYAALRDIPSARLILRHHPLRLRSAFLWNSLSRALA 82 Query: 76 IAGV-YDGFLIYNLMIRSGVRPDDHT 2 AG+ + +YN M+RSGVRPDD T Sbjct: 83 SAGLPSEALRVYNCMVRSGVRPDDRT 108 >gb|EEC69079.1| hypothetical protein OsI_37958 [Oryza sativa Indica Group] Length = 459 Score = 69.3 bits (168), Expect = 3e-10 Identities = 35/86 (40%), Positives = 55/86 (63%), Gaps = 1/86 (1%) Frame = -3 Query: 256 QTHAIALLNGYLPNSISISASLILQYATFGDPSTSRLLFYQSLPYSRSAFLWNTITRAYS 77 + HA +L++G L S+ ++ +L+L YA D +++ L+ RSAFLWN+++RA S Sbjct: 36 RAHAASLVSGALATSLPLAGALLLSYAALSDLASAHLVLRHHPLRLRSAFLWNSLSRALS 95 Query: 76 IAGV-YDGFLIYNLMIRSGVRPDDHT 2 A + + +YNLM+RS VRPDD T Sbjct: 96 SASLPSEALRVYNLMLRSAVRPDDRT 121