BLASTX nr result
ID: Atractylodes22_contig00056036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00056036 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002884639.1| predicted protein [Arabidopsis lyrata subsp.... 83 2e-14 ref|NP_187385.1| pentatricopeptide repeat-containing protein [Ar... 83 2e-14 emb|CBI35592.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002267896.2| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 >ref|XP_002884639.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330479|gb|EFH60898.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 864 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/88 (47%), Positives = 56/88 (63%), Gaps = 1/88 (1%) Frame = -1 Query: 286 LRSLSVTPYHLLSHVFHFTQKPSNDDTL-HDIATLIKHPNWEQNKHLNSLASYMSPESAC 110 LR PY+ V + S+D H++A+L+K PNWE+N L SL S+MSP A Sbjct: 14 LRRHVFPPYNAFFSVSSRPSQFSSDQVAAHNVASLLKSPNWEKNSSLKSLVSHMSPNVAS 73 Query: 109 KVISLHRENIELCVRFFKWVCKHSSFEF 26 +VISL R + ++CVRFF WVCKHSS+ F Sbjct: 74 QVISLQRSDNDICVRFFMWVCKHSSYCF 101 >ref|NP_187385.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75204605|sp|Q9SFV9.1|PP218_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g07290, mitochondrial; Flags: Precursor gi|6642636|gb|AAF20217.1|AC012395_4 hypothetical protein [Arabidopsis thaliana] gi|332641002|gb|AEE74523.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 880 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/65 (55%), Positives = 49/65 (75%) Frame = -1 Query: 220 SNDDTLHDIATLIKHPNWEQNKHLNSLASYMSPESACKVISLHRENIELCVRFFKWVCKH 41 S++ HD+A+L+K PNWE+N L SL S+M+P A +VISL R + ++CVRFF WVCKH Sbjct: 37 SDEVAAHDVASLLKTPNWEKNSSLKSLVSHMNPNVASQVISLQRSDNDICVRFFMWVCKH 96 Query: 40 SSFEF 26 SS+ F Sbjct: 97 SSYCF 101 >emb|CBI35592.3| unnamed protein product [Vitis vinifera] Length = 883 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/78 (44%), Positives = 47/78 (60%) Frame = -1 Query: 265 PYHLLSHVFHFTQKPSNDDTLHDIATLIKHPNWEQNKHLNSLASYMSPESACKVISLHRE 86 P+ S + + + T I+ LI PNWE +K L SLAS+M+P A K+I L Sbjct: 22 PFMFSSLSLQSSSNQTTEGTAFHISNLINKPNWEHDKTLKSLASHMTPHLAGKIIGLQSN 81 Query: 85 NIELCVRFFKWVCKHSSF 32 N+EL VRFFKWVC+ SS+ Sbjct: 82 NVELGVRFFKWVCRQSSY 99 >ref|XP_002267896.2| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, mitochondrial [Vitis vinifera] Length = 876 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/63 (52%), Positives = 43/63 (68%) Frame = -1 Query: 220 SNDDTLHDIATLIKHPNWEQNKHLNSLASYMSPESACKVISLHRENIELCVRFFKWVCKH 41 + + T I+ LI PNWE +K L SLAS+M+P A K+I L N+EL VRFFKWVC+ Sbjct: 14 TTEGTAFHISNLINKPNWEHDKTLKSLASHMTPHLAGKIIGLQSNNVELGVRFFKWVCRQ 73 Query: 40 SSF 32 SS+ Sbjct: 74 SSY 76