BLASTX nr result
ID: Atractylodes22_contig00055867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055867 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_002525211.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Vitis vinifera] Length = 667 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +2 Query: 5 GTSWIETPGGMRSFMAKDVSNEKTEEIYVTLGGLFNLMREERYAVSEGCNEE 160 GTSWIET GG+RSF+A+DVS+E++EEIY L GL LMREE Y + + +EE Sbjct: 612 GTSWIETSGGLRSFIARDVSSERSEEIYGMLEGLLGLMREEGYTLQDELDEE 663 >ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Glycine max] Length = 667 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +2 Query: 5 GTSWIETPGGMRSFMAKDVSNEKTEEIYVTLGGLFNLMREERYAVSEGCNEESI 166 G+SWIET GG+ SF+AKDVSN +++EIY L GL LMREE + E + E++ Sbjct: 612 GSSWIETSGGLLSFIAKDVSNGRSDEIYALLEGLLGLMREEGCVLQEELDYENV 665 >ref|XP_002525211.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535508|gb|EEF37177.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 654 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +2 Query: 5 GTSWIETPGGMRSFMAKDVSNEKTEEIYVTLGGLFNLMREERYAVSEGCNEESI 166 G+SWIET G+RSF+A D E EEI+V L GL LMR+E + + +EESI Sbjct: 599 GSSWIETSEGLRSFIATDTCTENVEEIHVILKGLLGLMRDEGKVLQDMLDEESI 652