BLASTX nr result
ID: Atractylodes22_contig00055584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055584 (198 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520572.1| pentatricopeptide repeat-containing protein,... 99 4e-19 emb|CAN67593.1| hypothetical protein VITISV_000699 [Vitis vinifera] 97 1e-18 ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-18 ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-18 ref|XP_002308772.1| predicted protein [Populus trichocarpa] gi|2... 96 2e-18 >ref|XP_002520572.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540232|gb|EEF41805.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 99.0 bits (245), Expect = 4e-19 Identities = 45/64 (70%), Positives = 57/64 (89%) Frame = -2 Query: 194 MILGYGQHGMGKKSLQLFYSMRDSGIQPDSVTIVAVLYACSYAGLVDEGLQLFESLEVEY 15 MILGYGQHGMG+ +L LF+SM+ SGIQPD++T VAVL ACSYAGLVDEGL++FES++ ++ Sbjct: 479 MILGYGQHGMGENALSLFHSMKKSGIQPDAITFVAVLSACSYAGLVDEGLRIFESMKRDF 538 Query: 14 KIVP 3 KI P Sbjct: 539 KIQP 542 >emb|CAN67593.1| hypothetical protein VITISV_000699 [Vitis vinifera] Length = 825 Score = 97.4 bits (241), Expect = 1e-18 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = -2 Query: 194 MILGYGQHGMGKKSLQLFYSMRDSGIQPDSVTIVAVLYACSYAGLVDEGLQLFESLEVEY 15 MIL YGQHGMG+++L LF++M SGI+PDSVT VA+L ACSYAGLVDEGL++F+S+E EY Sbjct: 597 MILSYGQHGMGERALSLFHAMLGSGIKPDSVTFVAILSACSYAGLVDEGLRIFQSMEREY 656 Query: 14 KIVP 3 KI P Sbjct: 657 KIQP 660 >ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 817 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = -2 Query: 194 MILGYGQHGMGKKSLQLFYSMRDSGIQPDSVTIVAVLYACSYAGLVDEGLQLFESLEVEY 15 MILGYGQHGMG+ +L +F+ M+ SGIQPD+VT+VAVL ACSYAGLVDEGLQ+FES+ Y Sbjct: 589 MILGYGQHGMGESALFMFHRMQKSGIQPDAVTLVAVLSACSYAGLVDEGLQIFESMRTVY 648 Query: 14 KIVP 3 I P Sbjct: 649 NIQP 652 >ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 793 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = -2 Query: 194 MILGYGQHGMGKKSLQLFYSMRDSGIQPDSVTIVAVLYACSYAGLVDEGLQLFESLEVEY 15 MILGYGQHGMG+ +L +F+ M+ SGIQPD+VT+VAVL ACSYAGLVDEGLQ+FES+ Y Sbjct: 565 MILGYGQHGMGESALFMFHRMQKSGIQPDAVTLVAVLSACSYAGLVDEGLQIFESMRTVY 624 Query: 14 KIVP 3 I P Sbjct: 625 NIQP 628 >ref|XP_002308772.1| predicted protein [Populus trichocarpa] gi|222854748|gb|EEE92295.1| predicted protein [Populus trichocarpa] Length = 320 Score = 96.3 bits (238), Expect = 2e-18 Identities = 42/64 (65%), Positives = 57/64 (89%) Frame = -2 Query: 194 MILGYGQHGMGKKSLQLFYSMRDSGIQPDSVTIVAVLYACSYAGLVDEGLQLFESLEVEY 15 MIL YGQHGMG+++L LF+SM+ SGI+PD++T +AVL ACS++GLVDEGLQ+FES+E ++ Sbjct: 102 MILAYGQHGMGERALSLFHSMKKSGIEPDAITFIAVLSACSHSGLVDEGLQIFESMEKDF 161 Query: 14 KIVP 3 KI P Sbjct: 162 KIQP 165