BLASTX nr result
ID: Atractylodes22_contig00055581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055581 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265348.1| PREDICTED: cytochrome P450 78A4 isoform 2 [V... 70 1e-10 ref|XP_002265310.1| PREDICTED: cytochrome P450 78A4 isoform 1 [V... 70 1e-10 emb|CAN80496.1| hypothetical protein VITISV_000124 [Vitis vinifera] 70 1e-10 ref|XP_003517846.1| PREDICTED: cytochrome P450 78A4-like [Glycin... 70 2e-10 dbj|BAK05332.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 2e-10 >ref|XP_002265348.1| PREDICTED: cytochrome P450 78A4 isoform 2 [Vitis vinifera] Length = 548 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +1 Query: 1 VHLWLAQLLQNFKWVA-DGSVDMSECLKMSLEMKKPLVCKAVAR 129 V LWLAQLLQNFKWVA D VD+SECLK+S+EMK+ LVCKAV R Sbjct: 503 VQLWLAQLLQNFKWVACDSGVDLSECLKLSMEMKQSLVCKAVPR 546 >ref|XP_002265310.1| PREDICTED: cytochrome P450 78A4 isoform 1 [Vitis vinifera] Length = 525 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +1 Query: 1 VHLWLAQLLQNFKWVA-DGSVDMSECLKMSLEMKKPLVCKAVAR 129 V LWLAQLLQNFKWVA D VD+SECLK+S+EMK+ LVCKAV R Sbjct: 480 VQLWLAQLLQNFKWVACDSGVDLSECLKLSMEMKQSLVCKAVPR 523 >emb|CAN80496.1| hypothetical protein VITISV_000124 [Vitis vinifera] Length = 525 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +1 Query: 1 VHLWLAQLLQNFKWVA-DGSVDMSECLKMSLEMKKPLVCKAVAR 129 V LWLAQLLQNFKWVA D VD+SECLK+S+EMK+ LVCKAV R Sbjct: 480 VQLWLAQLLQNFKWVACDSGVDLSECLKLSMEMKQSLVCKAVPR 523 >ref|XP_003517846.1| PREDICTED: cytochrome P450 78A4-like [Glycine max] Length = 520 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/46 (76%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = +1 Query: 1 VHLWLAQLLQNFKWVA-DG-SVDMSECLKMSLEMKKPLVCKAVARV 132 VHLWLAQLLQNF WV DG SV++ ECLK+S+EMKKPL CKAV RV Sbjct: 473 VHLWLAQLLQNFHWVQFDGVSVELDECLKLSMEMKKPLACKAVPRV 518 >dbj|BAK05332.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 505 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +1 Query: 1 VHLWLAQLLQNFKWVADGSVDMSECLKMSLEMKKPLVCKAVAR 129 VHLWLAQLL F+W GSVD+SE LKMSLEM PLVCKAVAR Sbjct: 463 VHLWLAQLLHRFEWAPSGSVDLSERLKMSLEMATPLVCKAVAR 505