BLASTX nr result
ID: Atractylodes22_contig00055491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055491 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525345.1| Spotted leaf protein, putative [Ricinus comm... 117 7e-25 ref|XP_003613244.1| U-box domain containing protein [Medicago tr... 117 1e-24 ref|XP_003550742.1| PREDICTED: U-box domain-containing protein 1... 114 1e-23 ref|XP_002888147.1| armadillo/beta-catenin repeat family protein... 112 3e-23 ref|XP_002511423.1| Spotted leaf protein, putative [Ricinus comm... 112 4e-23 >ref|XP_002525345.1| Spotted leaf protein, putative [Ricinus communis] gi|223535308|gb|EEF36983.1| Spotted leaf protein, putative [Ricinus communis] Length = 621 Score = 117 bits (294), Expect = 7e-25 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = +3 Query: 63 LIKSLNVDDFRCPISLEIMSDPVTLTTGHTYDRASIEKWFRSGNSTCPKTGEKVNSGNLV 242 L+ +NVDDFRCPISLEIM DPVT+ TGHTYDR+SI KWFRSGN TCPKTG+++ S L+ Sbjct: 208 LLSIINVDDFRCPISLEIMKDPVTIETGHTYDRSSILKWFRSGNPTCPKTGKRLGSIELI 267 Query: 243 SNLCIRSIIKQYCLERGISIA 305 NL ++ +I+Q+C++ GI A Sbjct: 268 PNLLLKGLIQQFCIQNGIPTA 288 >ref|XP_003613244.1| U-box domain containing protein [Medicago truncatula] gi|355514579|gb|AES96202.1| U-box domain containing protein [Medicago truncatula] Length = 689 Score = 117 bits (293), Expect = 1e-24 Identities = 54/81 (66%), Positives = 64/81 (79%) Frame = +3 Query: 63 LIKSLNVDDFRCPISLEIMSDPVTLTTGHTYDRASIEKWFRSGNSTCPKTGEKVNSGNLV 242 ++ LN DDFRCPISLE+MSDPVT+ TGHTYDR+SI KWFRSGNSTCPKTG+ + S LV Sbjct: 275 ILSCLNSDDFRCPISLELMSDPVTIETGHTYDRSSILKWFRSGNSTCPKTGKSLGSIELV 334 Query: 243 SNLCIRSIIKQYCLERGISIA 305 NL +R +I+QYC GI A Sbjct: 335 PNLVLRRLIQQYCNVNGIPFA 355 >ref|XP_003550742.1| PREDICTED: U-box domain-containing protein 19-like [Glycine max] Length = 676 Score = 114 bits (284), Expect = 1e-23 Identities = 48/81 (59%), Positives = 68/81 (83%) Frame = +3 Query: 63 LIKSLNVDDFRCPISLEIMSDPVTLTTGHTYDRASIEKWFRSGNSTCPKTGEKVNSGNLV 242 L+ S+N DDFRCPISLE+M+DPVT++TG TYDRASI+KW ++GN+ CPKTGEK+ + +LV Sbjct: 264 LLTSVNPDDFRCPISLELMTDPVTVSTGQTYDRASIQKWLKAGNTKCPKTGEKLTNTDLV 323 Query: 243 SNLCIRSIIKQYCLERGISIA 305 N ++ +I+Q+C + GIS+A Sbjct: 324 PNTTLKRLIQQFCADNGISVA 344 >ref|XP_002888147.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297333988|gb|EFH64406.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 686 Score = 112 bits (280), Expect = 3e-23 Identities = 50/78 (64%), Positives = 61/78 (78%) Frame = +3 Query: 63 LIKSLNVDDFRCPISLEIMSDPVTLTTGHTYDRASIEKWFRSGNSTCPKTGEKVNSGNLV 242 +I+SLNVDD RCPISLEIMSDPV L TGHTYDR+SI KWF SGN TCPKTG+ + S LV Sbjct: 273 MIRSLNVDDLRCPISLEIMSDPVVLETGHTYDRSSITKWFASGNITCPKTGKTLVSTMLV 332 Query: 243 SNLCIRSIIKQYCLERGI 296 N ++ +I+ YC + G+ Sbjct: 333 DNFSVKQVIQSYCKQNGV 350 >ref|XP_002511423.1| Spotted leaf protein, putative [Ricinus communis] gi|223550538|gb|EEF52025.1| Spotted leaf protein, putative [Ricinus communis] Length = 682 Score = 112 bits (279), Expect = 4e-23 Identities = 47/80 (58%), Positives = 65/80 (81%) Frame = +3 Query: 66 IKSLNVDDFRCPISLEIMSDPVTLTTGHTYDRASIEKWFRSGNSTCPKTGEKVNSGNLVS 245 + LN +DFRCPISLE+M+DPVT++TG TYDR+SIEKW ++GN TCPKTGEK+ S LV Sbjct: 272 LSCLNPEDFRCPISLELMTDPVTVSTGQTYDRSSIEKWLKAGNMTCPKTGEKLKSSELVP 331 Query: 246 NLCIRSIIKQYCLERGISIA 305 N +R +I+++C + GIS++ Sbjct: 332 NATLRKLIQKFCADNGISLS 351