BLASTX nr result
ID: Atractylodes22_contig00055460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055460 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143565.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containi... 76 2e-12 ref|XP_002532046.1| pentatricopeptide repeat-containing protein,... 76 2e-12 ref|XP_003630096.1| Pentatricopeptide repeat-containing protein ... 75 4e-12 ref|XP_004169853.1| PREDICTED: pentatricopeptide repeat-containi... 75 5e-12 >ref|XP_004143565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Cucumis sativus] Length = 528 Score = 79.7 bits (195), Expect = 2e-13 Identities = 38/66 (57%), Positives = 50/66 (75%) Frame = +1 Query: 1 LLYKSYTKANMKELLQKLLKHMDRNGIVPNKRFFLDALGVLGSSLDDRDSIATKVNSRMP 180 LLYK+YTKA+ KELL+KLLK+MD+ GI+PNKRFFLDALG +GSS + + T+ SR Sbjct: 417 LLYKAYTKADKKELLEKLLKNMDKAGIIPNKRFFLDALGTIGSSQEKPEPARTRTGSRNS 476 Query: 181 AADITK 198 + + K Sbjct: 477 DSSVEK 482 >ref|XP_003524280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Glycine max] Length = 503 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/58 (63%), Positives = 45/58 (77%) Frame = +1 Query: 1 LLYKSYTKANMKELLQKLLKHMDRNGIVPNKRFFLDALGVLGSSLDDRDSIATKVNSR 174 LLYK+YTKAN KELL KLLKHMD++GIVPNKRFFLDALG + S + +S +S+ Sbjct: 399 LLYKAYTKANQKELLDKLLKHMDKDGIVPNKRFFLDALGAVASLPANSESANAATDSK 456 >ref|XP_002532046.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528289|gb|EEF30336.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 478 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +1 Query: 1 LLYKSYTKANMKELLQKLLKHMDRNGIVPNKRFFLDALGVLGS 129 LLYK+YTKANMK+L+QKLLKHMDR+GI+PNKRFFLDALG S Sbjct: 422 LLYKAYTKANMKKLVQKLLKHMDRDGIIPNKRFFLDALGAFKS 464 >ref|XP_003630096.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524118|gb|AET04572.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 635 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/60 (60%), Positives = 43/60 (71%) Frame = +1 Query: 1 LLYKSYTKANMKELLQKLLKHMDRNGIVPNKRFFLDALGVLGSSLDDRDSIATKVNSRMP 180 LLYK+YTKAN KELL KLLK MD++ ++PNKRFFLDALG +GSS + S S P Sbjct: 407 LLYKAYTKANSKELLDKLLKQMDKDSVIPNKRFFLDALGAIGSSTEKSGSANAGTGSSRP 466 >ref|XP_004169853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Cucumis sativus] Length = 494 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/49 (69%), Positives = 45/49 (91%) Frame = +1 Query: 1 LLYKSYTKANMKELLQKLLKHMDRNGIVPNKRFFLDALGVLGSSLDDRD 147 LLYK+YTKA+ KELL+KLLK+MD+ GI+PNKRFFLDALG +GSS ++++ Sbjct: 417 LLYKAYTKADKKELLEKLLKNMDKAGIIPNKRFFLDALGTIGSSQENQN 465