BLASTX nr result
ID: Atractylodes22_contig00055437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055437 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518258.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 >ref|XP_002518258.1| conserved hypothetical protein [Ricinus communis] gi|223542605|gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 94 SNENKESFWARQERNSPFDTKG*ERIAGDDLVKGIYER 207 + NK+SFWARQERNSPFDTK E IAGDDLVKGIYER Sbjct: 117 TKSNKDSFWARQERNSPFDTKRQELIAGDDLVKGIYER 154