BLASTX nr result
ID: Atractylodes22_contig00055436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055436 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 152 4e-35 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 152 4e-35 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 152 4e-35 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 141 5e-32 ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containi... 140 8e-32 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 152 bits (383), Expect = 4e-35 Identities = 72/84 (85%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKLIKEDGYIPDTDYVLLDVEEEEKERSLYYHSEKLAIAFGLISTPSSTTIRVIKNLRVC 180 +K I+EDGY+PDT++VLLDVE+EEKERSLYYHSEKLAIA+GLISTP+STTIRVIKNLRVC Sbjct: 1481 MKTIREDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVC 1540 Query: 181 GDCHNAIKHISKVCQREIVLRDAN 252 GDCHNAIK+ISKV +REIVLRDAN Sbjct: 1541 GDCHNAIKYISKVFEREIVLRDAN 1564 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 152 bits (383), Expect = 4e-35 Identities = 72/84 (85%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKLIKEDGYIPDTDYVLLDVEEEEKERSLYYHSEKLAIAFGLISTPSSTTIRVIKNLRVC 180 +K I+EDGY+PDT++VLLDVE+EEKERSLYYHSEKLAIA+GLISTP+STTIRVIKNLRVC Sbjct: 766 MKTIREDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVC 825 Query: 181 GDCHNAIKHISKVCQREIVLRDAN 252 GDCHNAIK+ISKV +REIVLRDAN Sbjct: 826 GDCHNAIKYISKVFEREIVLRDAN 849 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 152 bits (383), Expect = 4e-35 Identities = 72/84 (85%), Positives = 82/84 (97%) Frame = +1 Query: 1 IKLIKEDGYIPDTDYVLLDVEEEEKERSLYYHSEKLAIAFGLISTPSSTTIRVIKNLRVC 180 +K I+EDGY+PDT++VLLDVE+EEKERSLYYHSEKLAIA+GLISTP+STTIRVIKNLRVC Sbjct: 404 MKTIREDGYVPDTEFVLLDVEDEEKERSLYYHSEKLAIAYGLISTPASTTIRVIKNLRVC 463 Query: 181 GDCHNAIKHISKVCQREIVLRDAN 252 GDCHNAIK+ISKV +REIVLRDAN Sbjct: 464 GDCHNAIKYISKVFEREIVLRDAN 487 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 141 bits (356), Expect = 5e-32 Identities = 66/84 (78%), Positives = 78/84 (92%) Frame = +1 Query: 1 IKLIKEDGYIPDTDYVLLDVEEEEKERSLYYHSEKLAIAFGLISTPSSTTIRVIKNLRVC 180 I+ IK++GY+P+TD+ L+DVEEEEKER+LYYHSEKLA+AFGL+STP ST IRVIKNLRVC Sbjct: 898 IRDIKQEGYVPETDFTLVDVEEEEKERALYYHSEKLAVAFGLLSTPPSTPIRVIKNLRVC 957 Query: 181 GDCHNAIKHISKVCQREIVLRDAN 252 GDCHNA+K+ISKV REIVLRDAN Sbjct: 958 GDCHNAMKYISKVYDREIVLRDAN 981 >ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1582 Score = 140 bits (354), Expect = 8e-32 Identities = 65/84 (77%), Positives = 78/84 (92%) Frame = +1 Query: 1 IKLIKEDGYIPDTDYVLLDVEEEEKERSLYYHSEKLAIAFGLISTPSSTTIRVIKNLRVC 180 +K I+E+GY+PDTD+ L+DVEEE+KE SLYYHSEKLAIA+GL+ TP STT+RVIKNLRVC Sbjct: 1483 MKRIREEGYLPDTDFALVDVEEEDKECSLYYHSEKLAIAYGLMKTPPSTTLRVIKNLRVC 1542 Query: 181 GDCHNAIKHISKVCQREIVLRDAN 252 GDCHNAIK+ISKV +RE+VLRDAN Sbjct: 1543 GDCHNAIKYISKVFEREVVLRDAN 1566