BLASTX nr result
ID: Atractylodes22_contig00055367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055367 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267683.2| PREDICTED: uncharacterized protein LOC100249... 77 1e-12 emb|CBI39790.3| unnamed protein product [Vitis vinifera] 77 1e-12 emb|CAN72861.1| hypothetical protein VITISV_026660 [Vitis vinifera] 70 1e-10 ref|XP_003600395.1| hypothetical protein MTR_3g060710 [Medicago ... 70 2e-10 ref|XP_002532512.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 >ref|XP_002267683.2| PREDICTED: uncharacterized protein LOC100249836 [Vitis vinifera] Length = 1552 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +2 Query: 86 MGKRKERRLAAKTAANRRVKLDLLAEPSGDFGDLPSKEEVGGGDSAKNHAGSPNSPSSS 262 MG+RKERRLAA +A+ RRVKLDL AEPSGD G ++EVGG +K A SPNSPSSS Sbjct: 1 MGRRKERRLAAISASGRRVKLDLFAEPSGDLGGSSVRDEVGGDLDSKRRAASPNSPSSS 59 >emb|CBI39790.3| unnamed protein product [Vitis vinifera] Length = 820 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +2 Query: 86 MGKRKERRLAAKTAANRRVKLDLLAEPSGDFGDLPSKEEVGGGDSAKNHAGSPNSPSSS 262 MG+RKERRLAA +A+ RRVKLDL AEPSGD G ++EVGG +K A SPNSPSSS Sbjct: 1 MGRRKERRLAAISASGRRVKLDLFAEPSGDLGGSSVRDEVGGDLDSKRRAASPNSPSSS 59 >emb|CAN72861.1| hypothetical protein VITISV_026660 [Vitis vinifera] Length = 993 Score = 70.5 bits (171), Expect = 1e-10 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 6/65 (9%) Frame = +2 Query: 86 MGKRKERRLAAKTAANRRVKLDLLAEPS------GDFGDLPSKEEVGGGDSAKNHAGSPN 247 MG+RKERRLAA +A+ RRVKLDL AEPS GD G ++EVGG +K A SPN Sbjct: 1 MGRRKERRLAAISASGRRVKLDLFAEPSDLFNSLGDLGGSSVRDEVGGDLDSKRRAASPN 60 Query: 248 SPSSS 262 SPSSS Sbjct: 61 SPSSS 65 >ref|XP_003600395.1| hypothetical protein MTR_3g060710 [Medicago truncatula] gi|355489443|gb|AES70646.1| hypothetical protein MTR_3g060710 [Medicago truncatula] Length = 625 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = +2 Query: 86 MGKRKERRLAAKTAANRRVKLDLLAEPSGDFGDLPSKEEVGGGDSAKNHAGSPNSPSSS 262 MG RKERR AA + A RRVKLDL AEPSG+ G P + GG +++ H G PNSPSSS Sbjct: 1 MGNRKERRRAAHSNAGRRVKLDLFAEPSGELGGSPIHGDAGGDANSQQHDGLPNSPSSS 59 >ref|XP_002532512.1| conserved hypothetical protein [Ricinus communis] gi|223527762|gb|EEF29864.1| conserved hypothetical protein [Ricinus communis] Length = 964 Score = 66.2 bits (160), Expect = 3e-09 Identities = 37/59 (62%), Positives = 38/59 (64%) Frame = +2 Query: 86 MGKRKERRLAAKTAANRRVKLDLLAEPSGDFGDLPSKEEVGGGDSAKNHAGSPNSPSSS 262 MGKRKERRLAA + A RRVKLDL AEPSGD G EVG A PNSPSSS Sbjct: 1 MGKRKERRLAALSNAGRRVKLDLFAEPSGDLGGSSVNGEVGEDIDPTKRAELPNSPSSS 59