BLASTX nr result
ID: Atractylodes22_contig00055289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055289 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum] 77 2e-12 gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum] gi|125971776|gb... 77 2e-12 gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata] 76 3e-12 sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase ... 76 3e-12 dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana ben... 76 3e-12 >emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum] Length = 939 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/49 (67%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 115 ENYN-HHDHYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGS 258 EN++ HH H+HSDTE++G DR ++SGPLSGPLNKRG +KSARFNIP+ + Sbjct: 5 ENHHPHHQHHHSDTEIIGNDRASYSGPLSGPLNKRGGKKSARFNIPEST 53 >gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum] gi|125971776|gb|ABN58915.1| rbohD [Nicotiana tabacum] Length = 938 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/49 (67%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 115 ENYN-HHDHYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGS 258 EN++ HH H+HSDTE++G DR ++SGPLSGPLNKRG +KSARFNIP+ + Sbjct: 5 ENHHPHHQHHHSDTEIIGNDRASYSGPLSGPLNKRGGKKSARFNIPEST 53 >gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata] Length = 937 Score = 76.3 bits (186), Expect = 3e-12 Identities = 33/49 (67%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 115 ENYN-HHDHYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGS 258 EN++ HH H+HSDTE++G DR ++SGPLSGPLNKRG +KSARFNIP+ + Sbjct: 5 ENHHPHHHHHHSDTEIIGNDRASYSGPLSGPLNKRGGKKSARFNIPEST 53 >sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC gi|146219363|dbj|BAE79344.2| NADPH oxidase [Solanum tuberosum] Length = 938 Score = 76.3 bits (186), Expect = 3e-12 Identities = 33/49 (67%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 115 ENYN-HHDHYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGS 258 EN++ HH H+HSDTE++G DR ++SGPLSGPLNKRG +KSARFNIP+ + Sbjct: 5 ENHHPHHHHHHSDTEIIGNDRASYSGPLSGPLNKRGGKKSARFNIPEST 53 >dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana benthamiana] Length = 939 Score = 76.3 bits (186), Expect = 3e-12 Identities = 33/49 (67%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 115 ENYN-HHDHYHSDTEVVGVDRKAFSGPLSGPLNKRGHRKSARFNIPDGS 258 EN++ HH H+HSDTE++G DR ++SGPLSGPLNKRG +KSARFNIP+ + Sbjct: 5 ENHHPHHHHHHSDTEIIGNDRASYSGPLSGPLNKRGGKKSARFNIPEST 53