BLASTX nr result
ID: Atractylodes22_contig00055286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055286 (643 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF29401.1|AC009999_21 Contains similarity to CGI-141 protein... 80 3e-13 ref|NP_172070.2| lipase class 3-like protein [Arabidopsis thalia... 80 3e-13 ref|XP_002889565.1| hypothetical protein ARALYDRAFT_311660 [Arab... 80 3e-13 ref|NP_001077463.1| lipase class 3-like protein [Arabidopsis tha... 80 3e-13 ref|XP_002531019.1| protein with unknown function [Ricinus commu... 76 5e-12 >gb|AAF29401.1|AC009999_21 Contains similarity to CGI-141 protein from Homo sapiens gb|AF151899. ESTs gb|AI992525, gb|AA042356 come from this gene [Arabidopsis thaliana] Length = 983 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = -2 Query: 639 NFDIPLYRRWSTPDAQCVYEAYVANREAFMDMIVSPSMFIDHLPWRCSYALKKVLEKR 466 N +P++R W D Y+AYVANRE+F +++VSPSMF+DHLPWRC +AL+KVLE R Sbjct: 868 NMSVPIWRGWPICDVTDGYKAYVANRESFKEIMVSPSMFLDHLPWRCRHALQKVLESR 925 >ref|NP_172070.2| lipase class 3-like protein [Arabidopsis thaliana] gi|332189772|gb|AEE27893.1| lipase class 3-like protein [Arabidopsis thaliana] Length = 687 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = -2 Query: 639 NFDIPLYRRWSTPDAQCVYEAYVANREAFMDMIVSPSMFIDHLPWRCSYALKKVLEKR 466 N +P++R W D Y+AYVANRE+F +++VSPSMF+DHLPWRC +AL+KVLE R Sbjct: 617 NMSVPIWRGWPICDVTDGYKAYVANRESFKEIMVSPSMFLDHLPWRCRHALQKVLESR 674 >ref|XP_002889565.1| hypothetical protein ARALYDRAFT_311660 [Arabidopsis lyrata subsp. lyrata] gi|297335407|gb|EFH65824.1| hypothetical protein ARALYDRAFT_311660 [Arabidopsis lyrata subsp. lyrata] Length = 959 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = -2 Query: 639 NFDIPLYRRWSTPDAQCVYEAYVANREAFMDMIVSPSMFIDHLPWRCSYALKKVLEKR 466 N +P++R W D Y+AYVANRE+F +++VSPSMF+DHLPWRC +AL+KVLE R Sbjct: 863 NMSVPIWRGWPICDVTDGYKAYVANRESFKEIMVSPSMFLDHLPWRCRHALQKVLESR 920 >ref|NP_001077463.1| lipase class 3-like protein [Arabidopsis thaliana] gi|110737593|dbj|BAF00738.1| hypothetical protein [Arabidopsis thaliana] gi|332189773|gb|AEE27894.1| lipase class 3-like protein [Arabidopsis thaliana] Length = 516 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/58 (58%), Positives = 45/58 (77%) Frame = -2 Query: 639 NFDIPLYRRWSTPDAQCVYEAYVANREAFMDMIVSPSMFIDHLPWRCSYALKKVLEKR 466 N +P++R W D Y+AYVANRE+F +++VSPSMF+DHLPWRC +AL+KVLE R Sbjct: 446 NMSVPIWRGWPICDVTDGYKAYVANRESFKEIMVSPSMFLDHLPWRCRHALQKVLESR 503 >ref|XP_002531019.1| protein with unknown function [Ricinus communis] gi|223529394|gb|EEF31357.1| protein with unknown function [Ricinus communis] Length = 741 Score = 76.3 bits (186), Expect = 5e-12 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = -2 Query: 642 KNFDIPLYRRWSTPDAQCVYEAYVANREAFMDMIVSPSMFIDHLPWRCSYALKKVLE 472 +N +PL++ W + Y AY+ANRE F D++VSP+MF+DHLPWRC YA++KVLE Sbjct: 671 RNSSVPLWKSWRIQENVQSYNAYLANREDFKDIVVSPNMFLDHLPWRCHYAMQKVLE 727