BLASTX nr result
ID: Atractylodes22_contig00055274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055274 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528146.1| conserved hypothetical protein [Ricinus comm... 89 4e-16 ref|XP_002299388.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|NP_190347.2| uncharacterized protein [Arabidopsis thaliana] ... 82 3e-14 ref|NP_001030827.1| uncharacterized protein [Arabidopsis thalian... 82 3e-14 ref|XP_002877570.1| hypothetical protein ARALYDRAFT_485127 [Arab... 82 5e-14 >ref|XP_002528146.1| conserved hypothetical protein [Ricinus communis] gi|223532444|gb|EEF34237.1| conserved hypothetical protein [Ricinus communis] Length = 329 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 3 VGVHFNPFVSWNDKMYKYGVVHTDDLVQDVLNWERFYLSGRLQKP 137 VGVHFNPF++WNDKM KYGVV DLVQD+LNWERFYLSGRLQKP Sbjct: 86 VGVHFNPFITWNDKMLKYGVVRMHDLVQDILNWERFYLSGRLQKP 130 >ref|XP_002299388.1| predicted protein [Populus trichocarpa] gi|222846646|gb|EEE84193.1| predicted protein [Populus trichocarpa] Length = 294 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +3 Query: 3 VGVHFNPFVSWNDKMYKYGVVHTDDLVQDVLNWERFYLSGRLQKP 137 VGVHFNPFV+WNDKM KYGVV DLVQDVL+WERFYL GRLQKP Sbjct: 50 VGVHFNPFVTWNDKMLKYGVVRMHDLVQDVLHWERFYLCGRLQKP 94 >ref|NP_190347.2| uncharacterized protein [Arabidopsis thaliana] gi|332644788|gb|AEE78309.1| uncharacterized protein [Arabidopsis thaliana] Length = 320 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 VGVHFNPFVSWNDKMYKYGVVHTDDLVQDVLNWERFYLSGRLQKP 137 VGVHFNPFV+WND+ KYGVV DLVQD+L+W+RFYLSGRLQKP Sbjct: 74 VGVHFNPFVNWNDRKLKYGVVRMHDLVQDILDWKRFYLSGRLQKP 118 >ref|NP_001030827.1| uncharacterized protein [Arabidopsis thaliana] gi|6522546|emb|CAB61989.1| putative protein [Arabidopsis thaliana] gi|44681360|gb|AAS47620.1| At3g47630 [Arabidopsis thaliana] gi|56381935|gb|AAV85686.1| At3g47630 [Arabidopsis thaliana] gi|110738628|dbj|BAF01239.1| hypothetical protein [Arabidopsis thaliana] gi|332644789|gb|AEE78310.1| uncharacterized protein [Arabidopsis thaliana] Length = 332 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 VGVHFNPFVSWNDKMYKYGVVHTDDLVQDVLNWERFYLSGRLQKP 137 VGVHFNPFV+WND+ KYGVV DLVQD+L+W+RFYLSGRLQKP Sbjct: 86 VGVHFNPFVNWNDRKLKYGVVRMHDLVQDILDWKRFYLSGRLQKP 130 >ref|XP_002877570.1| hypothetical protein ARALYDRAFT_485127 [Arabidopsis lyrata subsp. lyrata] gi|297323408|gb|EFH53829.1| hypothetical protein ARALYDRAFT_485127 [Arabidopsis lyrata subsp. lyrata] Length = 332 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 VGVHFNPFVSWNDKMYKYGVVHTDDLVQDVLNWERFYLSGRLQKP 137 VGVHFNPFV+WND+ KYGVV DLVQD+L+W RFYLSGRLQKP Sbjct: 86 VGVHFNPFVNWNDRKLKYGVVRMHDLVQDILDWNRFYLSGRLQKP 130