BLASTX nr result
ID: Atractylodes22_contig00055113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055113 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK01684.1| predicted protein [Hordeum vulgare subsp. vulgare] 91 7e-17 ref|XP_002511379.1| conserved hypothetical protein [Ricinus comm... 85 5e-15 tpg|DAA46314.1| TPA: hypothetical protein ZEAMMB73_533502 [Zea m... 85 7e-15 ref|NP_001144204.1| uncharacterized protein LOC100277065 precurs... 85 7e-15 ref|XP_002467480.1| hypothetical protein SORBIDRAFT_01g028890 [S... 84 1e-14 >dbj|BAK01684.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 319 Score = 91.3 bits (225), Expect = 7e-17 Identities = 38/74 (51%), Positives = 50/74 (67%) Frame = +2 Query: 5 WSYGIRVKYAVEASNDSYCKACEATGGSCGHDVERFGPLCMCGSWNSTSNCDSIMKLSVG 184 W+YGIRV +A+ +N +C AC ATGG+CGHDVE G LC+CG WNSTSNCDS + Sbjct: 231 WAYGIRVAWALPEANRGFCGACRATGGACGHDVESRGDLCLCGDWNSTSNCDSSADAAPS 290 Query: 185 GTSTPVDKLSGLLI 226 + P ++ LL+ Sbjct: 291 SAAAPGAAIAALLL 304 >ref|XP_002511379.1| conserved hypothetical protein [Ricinus communis] gi|223550494|gb|EEF51981.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 85.1 bits (209), Expect = 5e-15 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = +2 Query: 2 EWSYGIRVKYAVEASNDSYCKACEATGGSCGHDVERFGPLCMCGSWNSTSNCDSI 166 EWSYGIRVKY+V+ N+ +C+ACEATGG+CG+ + LCMCG++NSTSNCDS+ Sbjct: 123 EWSYGIRVKYSVQG-NEEFCRACEATGGTCGYGTDGVKQLCMCGNFNSTSNCDSV 176 >tpg|DAA46314.1| TPA: hypothetical protein ZEAMMB73_533502 [Zea mays] Length = 332 Score = 84.7 bits (208), Expect = 7e-15 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +2 Query: 5 WSYGIRVKYAVEASNDSYCKACEATGGSCGHDVERFGPLCMCGSWNSTSNCDS 163 W+YGIRV + + SN +C AC ATGG+CGHD E LC+CG WNSTSNCDS Sbjct: 240 WAYGIRVSWTLPESNRGFCGACRATGGACGHDTESHADLCLCGDWNSTSNCDS 292 >ref|NP_001144204.1| uncharacterized protein LOC100277065 precursor [Zea mays] gi|195638406|gb|ACG38671.1| hypothetical protein [Zea mays] Length = 332 Score = 84.7 bits (208), Expect = 7e-15 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +2 Query: 5 WSYGIRVKYAVEASNDSYCKACEATGGSCGHDVERFGPLCMCGSWNSTSNCDS 163 W+YGIRV + + SN +C AC ATGG+CGHD E LC+CG WNSTSNCDS Sbjct: 240 WAYGIRVSWTLPESNRGFCGACRATGGACGHDTESHADLCLCGDWNSTSNCDS 292 >ref|XP_002467480.1| hypothetical protein SORBIDRAFT_01g028890 [Sorghum bicolor] gi|241921334|gb|EER94478.1| hypothetical protein SORBIDRAFT_01g028890 [Sorghum bicolor] Length = 331 Score = 84.0 bits (206), Expect = 1e-14 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 5 WSYGIRVKYAVEASNDSYCKACEATGGSCGHDVERFGPLCMCGSWNSTSNCDS 163 W+YGIRV + + SN +C AC ATGG+CGHD+E +C+CG WNSTSNCDS Sbjct: 245 WAYGIRVSWTLPESNRGFCGACRATGGACGHDMESHADVCLCGDWNSTSNCDS 297