BLASTX nr result
ID: Atractylodes22_contig00055073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00055073 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAQ76694.1| polyphenol oxidase [Taraxacum officinale] 55 6e-06 >emb|CAQ76694.1| polyphenol oxidase [Taraxacum officinale] Length = 594 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -2 Query: 242 KTRLRLGISELLEGLGVEDDDEHVVVKLVPRCDGVHVTISGKKIEIE 102 KTRLRLGISELL+ LG DDD++V+V LVP+ G V+I G KIE E Sbjct: 548 KTRLRLGISELLDDLGA-DDDDNVLVTLVPKNKGDEVSIKGMKIEYE 593