BLASTX nr result
ID: Atractylodes22_contig00054785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054785 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein ... 61 1e-07 ref|XP_002315879.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein ... 59 4e-07 ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein ... 57 1e-06 >ref|XP_003556095.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 1 MELKRPNDSVYSFPCPNCMCRTNRTEDSKT 90 +ELKRPNDS+YSFPCP+CMCR NRT+DS++ Sbjct: 531 VELKRPNDSIYSFPCPDCMCRANRTDDSRS 560 >ref|XP_002315879.1| predicted protein [Populus trichocarpa] gi|222864919|gb|EEF02050.1| predicted protein [Populus trichocarpa] Length = 569 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 4 ELKRPNDSVYSFPCPNCMCRTNRTEDSKT 90 ELKRPNDSVYS+PCP+CMCR NRTEDS++ Sbjct: 537 ELKRPNDSVYSYPCPDCMCRVNRTEDSRS 565 >ref|XP_003529417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 564 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +1 Query: 1 MELKRPNDSVYSFPCPNCMCRTNRTEDSKT 90 +ELKRPNDS+YSFPCP+CMCR+NRT+D ++ Sbjct: 531 VELKRPNDSIYSFPCPDCMCRSNRTDDLRS 560 >ref|XP_002311505.1| predicted protein [Populus trichocarpa] gi|222851325|gb|EEE88872.1| predicted protein [Populus trichocarpa] Length = 569 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +1 Query: 4 ELKRPNDSVYSFPCPNCMCRTNRTEDSKT 90 E+KRPNDS+YSFPCP+CMC NRTEDS++ Sbjct: 537 EIKRPNDSIYSFPCPDCMCHVNRTEDSRS 565 >ref|XP_002284457.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297737694|emb|CBI26895.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/29 (72%), Positives = 28/29 (96%) Frame = +1 Query: 4 ELKRPNDSVYSFPCPNCMCRTNRTEDSKT 90 ELKRPNDS+Y+FPCP+CMCR N++EDS++ Sbjct: 529 ELKRPNDSIYTFPCPDCMCRMNKSEDSRS 557