BLASTX nr result
ID: Atractylodes22_contig00054405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054405 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK33462.1| unknown [Medicago truncatula] 83 3e-14 ref|XP_003624764.1| Presenilin [Medicago truncatula] gi|35750896... 80 2e-13 ref|XP_002530952.1| conserved hypothetical protein [Ricinus comm... 79 3e-13 ref|XP_003567082.1| PREDICTED: presenilin-like protein At1g08700... 79 4e-13 dbj|BAJ85060.1| predicted protein [Hordeum vulgare subsp. vulgare] 79 4e-13 >gb|AFK33462.1| unknown [Medicago truncatula] Length = 423 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = -2 Query: 323 SVCRHALPALPISIALGIIFYFLTRILMEPFVVGTSTNLMMF 198 SVCRHALPALPISIALG++FYFLTR+LMEPF+VGT+TNLMMF Sbjct: 382 SVCRHALPALPISIALGVLFYFLTRLLMEPFIVGTATNLMMF 423 >ref|XP_003624764.1| Presenilin [Medicago truncatula] gi|357508963|ref|XP_003624770.1| Presenilin [Medicago truncatula] gi|355499779|gb|AES80982.1| Presenilin [Medicago truncatula] gi|355499785|gb|AES80988.1| Presenilin [Medicago truncatula] Length = 600 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -2 Query: 323 SVCRHALPALPISIALGIIFYFLTRILMEPFVVGTSTNLMMF*LSF 186 SVCRHALPALPISIALG++FYFLTR+LMEPF+VGT+TNLM+ +F Sbjct: 382 SVCRHALPALPISIALGVLFYFLTRLLMEPFIVGTATNLMIIQTAF 427 >ref|XP_002530952.1| conserved hypothetical protein [Ricinus communis] gi|223529467|gb|EEF31424.1| conserved hypothetical protein [Ricinus communis] Length = 455 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 323 SVCRHALPALPISIALGIIFYFLTRILMEPFVVGTSTNLMMF 198 SVCR ALPALPISI LGIIFYFLTR+LMEPF+VGT+TNLMMF Sbjct: 414 SVCRRALPALPISITLGIIFYFLTRLLMEPFIVGTATNLMMF 455 >ref|XP_003567082.1| PREDICTED: presenilin-like protein At1g08700-like [Brachypodium distachyon] Length = 472 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 323 SVCRHALPALPISIALGIIFYFLTRILMEPFVVGTSTNLMMF 198 S+CRHALPALPISI LG++FYFLTR+LMEPFVVG STNL+MF Sbjct: 431 SICRHALPALPISIMLGVVFYFLTRLLMEPFVVGASTNLVMF 472 >dbj|BAJ85060.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 460 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -2 Query: 323 SVCRHALPALPISIALGIIFYFLTRILMEPFVVGTSTNLMMF 198 S+CRHALPALPISI LG++FYFLTR+LMEPFVVG STNL+MF Sbjct: 419 SICRHALPALPISIMLGVVFYFLTRLLMEPFVVGASTNLVMF 460