BLASTX nr result
ID: Atractylodes22_contig00054236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054236 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] gi|7779... 39 5e-07 ref|YP_004891645.1| unnamed protein product (chloroplast) [Nicot... 39 7e-07 dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] 38 8e-07 >emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] gi|77799603|dbj|BAE46692.1| hypothetical protein [Nicotiana sylvestris] Length = 79 Score = 38.9 bits (89), Expect(3) = 5e-07 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +3 Query: 162 SEKL*TNDRTEIEIERVNIRPRKLYFLGLLNVGQSNTIKSK 284 SEK N EI IERVNIRPRKL+ L N+GQ N ++K Sbjct: 38 SEKSRVNPTNEIGIERVNIRPRKLFL--LQNLGQYNKGQNK 76 Score = 36.6 bits (83), Expect(3) = 5e-07 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 100 K*IRMIH*SGWRNRPETNSSIRKS 171 K I MIH SGWRN PE NS IR+S Sbjct: 15 KGILMIHWSGWRNEPEINSCIRRS 38 Score = 22.3 bits (46), Expect(3) = 5e-07 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 59 MGTMEPVNSKDSSE 100 MGT E VN+KDS E Sbjct: 1 MGTTELVNAKDSIE 14 >ref|YP_004891645.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453932|gb|AEO95590.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454043|gb|AEO95700.1| hypothetical protein [synthetic construct] Length = 79 Score = 38.9 bits (89), Expect(3) = 7e-07 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +3 Query: 162 SEKL*TNDRTEIEIERVNIRPRKLYFLGLLNVGQSNTIKSK 284 SEK N EI IERVNIRPRKL+ L N+GQ N ++K Sbjct: 38 SEKSRVNPTNEIGIERVNIRPRKLFL--LQNLGQYNKGQNK 76 Score = 36.2 bits (82), Expect(3) = 7e-07 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +1 Query: 100 K*IRMIH*SGWRNRPETNSSIRKS 171 K I M+H SGWRN PE NS IR+S Sbjct: 15 KGILMVHWSGWRNEPEINSCIRRS 38 Score = 22.3 bits (46), Expect(3) = 7e-07 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 59 MGTMEPVNSKDSSE 100 MGT E VN+KDS E Sbjct: 1 MGTTELVNAKDSIE 14 >dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] Length = 79 Score = 38.1 bits (87), Expect(3) = 8e-07 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +3 Query: 162 SEKL*TNDRTEIEIERVNIRPRKLYFLGLLNVGQSNTIKSK 284 SEK N EI IERVNIRPRKL+ L N+GQ N ++K Sbjct: 38 SEKSRVNPINEIGIERVNIRPRKLFL--LQNLGQYNKGQNK 76 Score = 36.6 bits (83), Expect(3) = 8e-07 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 100 K*IRMIH*SGWRNRPETNSSIRKS 171 K I MIH SGWRN PE NS IR+S Sbjct: 15 KGILMIHWSGWRNEPEINSCIRRS 38 Score = 22.3 bits (46), Expect(3) = 8e-07 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 59 MGTMEPVNSKDSSE 100 MGT E VN+KDS E Sbjct: 1 MGTTELVNAKDSIE 14