BLASTX nr result
ID: Atractylodes22_contig00054199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054199 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974873.1| THO complex, subunit 5 [Arabidopsis thaliana] g... 56 4e-06 ref|XP_002863717.1| hypothetical protein ARALYDRAFT_494728 [Arab... 56 4e-06 ref|NP_568616.1| THO complex, subunit 5 [Arabidopsis thaliana] g... 56 4e-06 >ref|NP_974873.1| THO complex, subunit 5 [Arabidopsis thaliana] gi|332007505|gb|AED94888.1| THO complex, subunit 5 [Arabidopsis thaliana] Length = 819 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 VNGRLVTRSYRGRDHRKMISWKDNGCSPGYP 94 V+G+L+ RS+RGRDHRKMISWK GC+ GYP Sbjct: 788 VDGKLLVRSFRGRDHRKMISWKGRGCASGYP 818 >ref|XP_002863717.1| hypothetical protein ARALYDRAFT_494728 [Arabidopsis lyrata subsp. lyrata] gi|297309552|gb|EFH39976.1| hypothetical protein ARALYDRAFT_494728 [Arabidopsis lyrata subsp. lyrata] Length = 815 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 VNGRLVTRSYRGRDHRKMISWKDNGCSPGYP 94 V+G+L+ RS+RGRDHRKMISWK GC+ GYP Sbjct: 784 VDGKLLVRSFRGRDHRKMISWKGKGCASGYP 814 >ref|NP_568616.1| THO complex, subunit 5 [Arabidopsis thaliana] gi|14532602|gb|AAK64029.1| unknown protein [Arabidopsis thaliana] gi|20259139|gb|AAM14285.1| unknown protein [Arabidopsis thaliana] gi|332007504|gb|AED94887.1| THO complex, subunit 5 [Arabidopsis thaliana] Length = 702 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 2 VNGRLVTRSYRGRDHRKMISWKDNGCSPGYP 94 V+G+L+ RS+RGRDHRKMISWK GC+ GYP Sbjct: 671 VDGKLLVRSFRGRDHRKMISWKGRGCASGYP 701