BLASTX nr result
ID: Atractylodes22_contig00054154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054154 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271847.2| PREDICTED: cytochrome P450 704C1-like [Vitis... 63 2e-08 ref|XP_002312255.1| cytochrome P450 [Populus trichocarpa] gi|222... 60 2e-07 ref|XP_003611900.1| Cytochrome P450 [Medicago truncatula] gi|355... 60 2e-07 ref|NP_177109.3| cytochrome P450, family 704, subfamily B, polyp... 57 2e-06 ref|XP_003609660.1| Cytochrome P450 [Medicago truncatula] gi|355... 57 2e-06 >ref|XP_002271847.2| PREDICTED: cytochrome P450 704C1-like [Vitis vinifera] Length = 817 Score = 63.2 bits (152), Expect = 2e-08 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 112 GYTTRILILACSIFTWIFLHRWNQRTNKGPKTWPLIG 2 GY IL+LAC++ TWI +HRW+QR KGPKTWPL+G Sbjct: 291 GYNMGILMLACTVLTWIAIHRWSQRHTKGPKTWPLVG 327 >ref|XP_002312255.1| cytochrome P450 [Populus trichocarpa] gi|222852075|gb|EEE89622.1| cytochrome P450 [Populus trichocarpa] Length = 482 Score = 60.1 bits (144), Expect = 2e-07 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -1 Query: 97 ILILACSIFTWIFLHRWNQRTNKGPKTWPLIG 2 +L+LAC + +WIF+HRWNQR +GPKTWP++G Sbjct: 22 VLMLACMVLSWIFIHRWNQRQKRGPKTWPIVG 53 >ref|XP_003611900.1| Cytochrome P450 [Medicago truncatula] gi|355513235|gb|AES94858.1| Cytochrome P450 [Medicago truncatula] Length = 531 Score = 59.7 bits (143), Expect = 2e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -1 Query: 97 ILILACSIFTWIFLHRWNQRTNKGPKTWPLIG 2 ++IL C IF+WIFLHRW+QR KGPKTWP +G Sbjct: 19 LVILICMIFSWIFLHRWSQRNKKGPKTWPFLG 50 >ref|NP_177109.3| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis thaliana] gi|12597799|gb|AAG60111.1|AC073178_22 cytochrome P450, putative [Arabidopsis thaliana] gi|332196812|gb|AEE34933.1| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis thaliana] Length = 524 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -1 Query: 94 LILACSIFTWIFLHRWNQRTNKGPKTWPLIG 2 L++AC + +WIFLHRW QR GPKTWPL+G Sbjct: 5 LVIACMVTSWIFLHRWGQRNKSGPKTWPLVG 35 >ref|XP_003609660.1| Cytochrome P450 [Medicago truncatula] gi|355510715|gb|AES91857.1| Cytochrome P450 [Medicago truncatula] Length = 516 Score = 57.0 bits (136), Expect = 2e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -1 Query: 97 ILILACSIFTWIFLHRWNQRTNKGPKTWPLIG 2 ++IL C I +WIFLHRW+QR KGPKTWP +G Sbjct: 4 LVILICMIVSWIFLHRWSQRNKKGPKTWPFLG 35