BLASTX nr result
ID: Atractylodes22_contig00054150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054150 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM78200.1| putative root hair defective 3 protein [Gossypium... 55 8e-06 gb|AAM78199.1| putative root hair defective 3 protein [Gossypium... 55 8e-06 gb|AAM78203.1| putative root hair defective 3 protein [Gossypioi... 55 8e-06 >gb|AAM78200.1| putative root hair defective 3 protein [Gossypium raimondii] gi|29836511|gb|AAM78202.1| putative root hair defective 3 protein [Gossypium barbadense] Length = 79 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -2 Query: 241 LPGVLSLSTRLLPTILNLMRKLSEQGQRP--NNPQTN 137 LPG+LS+ST+ LPT++NL+ KL+EQGQ P NNPQTN Sbjct: 1 LPGLLSISTKFLPTVMNLLTKLAEQGQSPATNNPQTN 37 >gb|AAM78199.1| putative root hair defective 3 protein [Gossypium herbaceum] gi|29836509|gb|AAM78201.1| putative root hair defective 3 protein [Gossypium barbadense] Length = 79 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -2 Query: 241 LPGVLSLSTRLLPTILNLMRKLSEQGQRP--NNPQTN 137 LPG+LS+ST+ LPT++NL+ KL+EQGQ P NNPQTN Sbjct: 1 LPGLLSISTKFLPTVMNLLTKLAEQGQSPATNNPQTN 37 >gb|AAM78203.1| putative root hair defective 3 protein [Gossypioides kirkii] Length = 79 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -2 Query: 241 LPGVLSLSTRLLPTILNLMRKLSEQGQRP--NNPQTN 137 LPG+LS+ST+ LPT++NL+ KL+EQGQ P NNPQTN Sbjct: 1 LPGLLSISTKFLPTVMNLLTKLAEQGQSPATNNPQTN 37