BLASTX nr result
ID: Atractylodes22_contig00054148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054148 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002892169.1| pentatricopeptide repeat-containing protein ... 69 3e-10 ref|NP_171855.1| pentatricopeptide repeat-containing protein [Ar... 67 2e-09 emb|CBI28908.3| unnamed protein product [Vitis vinifera] 66 3e-09 dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] 65 6e-09 ref|XP_002532772.1| pentatricopeptide repeat-containing protein,... 65 7e-09 >ref|XP_002892169.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338011|gb|EFH68428.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 662 Score = 69.3 bits (168), Expect = 3e-10 Identities = 41/97 (42%), Positives = 56/97 (57%), Gaps = 6/97 (6%) Frame = -2 Query: 279 MRKTVLKSLYPIIIYRPHSSSINGGRKIYYPVHNSPEPDSNLLFISNPR----WVFTATS 112 MR+ K ++ RPH SS + Y + DS L +S+ R WVF ++S Sbjct: 1 MRRFYRKPFSLALLNRPHCSSQS---LCLYKNGDFLSDDSKCLPLSSSRTSVRWVFNSSS 57 Query: 111 PPPPEWVQPINDTSNLITSHP--KPSPWVDQILNLLD 7 PPPEW++P ND S+L+ S+ +PSPWV QILNLLD Sbjct: 58 LPPPEWIEPFNDVSDLVKSNRNLQPSPWVSQILNLLD 94 >ref|NP_171855.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180297|sp|Q9LR67.1|PPR9_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g03560, mitochondrial; Flags: Precursor gi|9280662|gb|AAF86531.1|AC002560_24 F21B7.18 [Arabidopsis thaliana] gi|332189465|gb|AEE27586.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 66.6 bits (161), Expect = 2e-09 Identities = 40/97 (41%), Positives = 54/97 (55%), Gaps = 6/97 (6%) Frame = -2 Query: 279 MRKTVLKSLYPIIIYRPHSSSINGGRKIYYPVHNSPEPDSNLLFISNPR----WVFTATS 112 MR+ K ++ RPH SS + Y + DS +S+ R WVF ++S Sbjct: 1 MRRFYRKPFSVPLLNRPHCSSQS---HCLYKNGDFLSDDSKCSPLSSSRTSVRWVFNSSS 57 Query: 111 PPPPEWVQPINDTSNLITSHPK--PSPWVDQILNLLD 7 PPPEW++P ND S+L+ S+ PSPWV QILNLLD Sbjct: 58 LPPPEWIEPFNDVSDLVKSNRNLLPSPWVSQILNLLD 94 >emb|CBI28908.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 65.9 bits (159), Expect = 3e-09 Identities = 44/102 (43%), Positives = 59/102 (57%), Gaps = 11/102 (10%) Frame = -2 Query: 279 MRKTVLKSLYPIIIYRPHSSS-----INGGRKIYYPVHNSPEPDSNLLFI-----SNPRW 130 MRKT++K + P S N G I++P H P P ++ L SN RW Sbjct: 1 MRKTLIKRFSQAHLLLPFHSPQPPCPYNSG--IFHP-HLRPPPHASKLGSTSTVGSNSRW 57 Query: 129 VFTATSPPPPEWVQPINDTSNLITS-HPKPSPWVDQILNLLD 7 VFT +P PPEWV+P+ D S+L ++ P+PSPWV+QIL LLD Sbjct: 58 VFT--TPIPPEWVEPLYDLSDLASNPQPQPSPWVNQILKLLD 97 >dbj|BAF01006.1| hypothetical protein [Arabidopsis thaliana] Length = 642 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = -2 Query: 135 RWVFTATSPPPPEWVQPINDTSNLITSHPK--PSPWVDQILNLLD 7 RWVF ++S PPPEW++P ND S+L+ S+ PSPWV QILNLLD Sbjct: 32 RWVFNSSSLPPPEWIEPFNDVSDLVKSNRNLLPSPWVSQILNLLD 76 >ref|XP_002532772.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527482|gb|EEF29611.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 647 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/62 (53%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Frame = -2 Query: 183 HNSPEPDSNLLFISNPRWVFTATSPPPPEWVQPINDTSNLIT-SHP--KPSPWVDQILNL 13 +N+ E S L SN RWVFT+ S PPPEW+ P D S++ + +H KPSPWV+QIL L Sbjct: 25 YNNGESLSKLCLTSNRRWVFTSNSLPPPEWIDPFVDLSDVASRTHQDLKPSPWVNQILAL 84 Query: 12 LD 7 LD Sbjct: 85 LD 86