BLASTX nr result
ID: Atractylodes22_contig00054103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054103 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16054.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containi... 62 4e-08 ref|NP_190263.1| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_002877513.1| hypothetical protein ARALYDRAFT_905886 [Arab... 56 3e-06 >emb|CBI16054.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 62.4 bits (150), Expect = 4e-08 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 2/90 (2%) Frame = -2 Query: 268 QAPPTIQQSHFPIRTRRPSPVYSHTRHXXXXXXXXXXXXXXXXXNHQ--IQSLCKKRHLK 95 Q P TIQQ H P +P+ + + N+ IQSLCK+ +L Sbjct: 5 QTPQTIQQPHLPKPFHKPTAISPKPQCCLALRPSTTTRSNGDSNNNNPLIQSLCKQGNLN 64 Query: 94 QAIQALTQESNPTQRTYELLILSCAIAKSL 5 QA+Q L+QE NPTQ TYELLILSC SL Sbjct: 65 QALQVLSQEPNPTQHTYELLILSCTRQNSL 94 >ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic [Vitis vinifera] Length = 658 Score = 62.4 bits (150), Expect = 4e-08 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 2/90 (2%) Frame = -2 Query: 268 QAPPTIQQSHFPIRTRRPSPVYSHTRHXXXXXXXXXXXXXXXXXNHQ--IQSLCKKRHLK 95 Q P TIQQ H P +P+ + + N+ IQSLCK+ +L Sbjct: 5 QTPQTIQQPHLPKPFHKPTAISPKPQCCLALRPSTTTRSNGDSNNNNPLIQSLCKQGNLN 64 Query: 94 QAIQALTQESNPTQRTYELLILSCAIAKSL 5 QA+Q L+QE NPTQ TYELLILSC SL Sbjct: 65 QALQVLSQEPNPTQHTYELLILSCTRQNSL 94 >ref|NP_190263.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207666|sp|Q9STF3.1|PP265_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g46790, chloroplastic; AltName: Full=Protein CHLORORESPIRATORY REDUCTION 2; Flags: Precursor gi|5541680|emb|CAB51186.1| putative protein [Arabidopsis thaliana] gi|110741961|dbj|BAE98921.1| hypothetical protein [Arabidopsis thaliana] gi|332644684|gb|AEE78205.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 657 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 127 IQSLCKKRHLKQAIQALTQESNPTQRTYELLILSCAIAKSLS 2 IQSLCK+ LKQAI+ L+QES+P+Q+TYELLIL C SLS Sbjct: 53 IQSLCKEGKLKQAIRVLSQESSPSQQTYELLILCCGHRSSLS 94 >ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449474033|ref|XP_004154055.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449510921|ref|XP_004163811.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] Length = 649 Score = 56.2 bits (134), Expect = 3e-06 Identities = 37/80 (46%), Positives = 44/80 (55%), Gaps = 2/80 (2%) Frame = -2 Query: 235 PIRTRRP--SPVYSHTRHXXXXXXXXXXXXXXXXXNHQIQSLCKKRHLKQAIQALTQESN 62 P T P SP YS ++ NH IQSLCK+ +LKQA+ L+ ESN Sbjct: 7 PYSTHYPPSSPRYSTSKLSVSSFSFNPSTPPNSNNNHLIQSLCKQGNLKQALYLLSHESN 66 Query: 61 PTQRTYELLILSCAIAKSLS 2 PTQ+T ELLILS A SLS Sbjct: 67 PTQQTCELLILSAARRNSLS 86 >ref|XP_002877513.1| hypothetical protein ARALYDRAFT_905886 [Arabidopsis lyrata subsp. lyrata] gi|297323351|gb|EFH53772.1| hypothetical protein ARALYDRAFT_905886 [Arabidopsis lyrata subsp. lyrata] Length = 657 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 127 IQSLCKKRHLKQAIQALTQESNPTQRTYELLILSCAIAKSLS 2 IQSLCK+ LKQA++ L+QES+P+Q+TYELLIL C SLS Sbjct: 53 IQSLCKEGKLKQALRVLSQESSPSQQTYELLILCCGHRSSLS 94