BLASTX nr result
ID: Atractylodes22_contig00054031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054031 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517055.1| cation-transporting atpase plant, putative [... 150 1e-34 ref|XP_002279888.1| PREDICTED: putative calcium-transporting ATP... 148 4e-34 ref|XP_002283579.1| PREDICTED: putative calcium-transporting ATP... 147 1e-33 ref|XP_002274787.1| PREDICTED: calcium-transporting ATPase 12, p... 145 3e-33 ref|XP_002279629.1| PREDICTED: putative calcium-transporting ATP... 145 3e-33 >ref|XP_002517055.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223543690|gb|EEF45218.1| cation-transporting atpase plant, putative [Ricinus communis] Length = 1018 Score = 150 bits (379), Expect = 1e-34 Identities = 68/85 (80%), Positives = 79/85 (92%) Frame = -2 Query: 256 MHKPPVGRVAPLITNVMWRNLLAQSLYQIVILLTFQFKGKSIFNVNERVKNTIIFNTFVL 77 M KPP+GR PLITN+MWRNLLAQ+LYQI +LLT QFKGKSIF+VNE+V +T+IFNTFVL Sbjct: 865 MDKPPIGRTEPLITNIMWRNLLAQALYQITVLLTLQFKGKSIFDVNEKVNDTLIFNTFVL 924 Query: 76 CQVFNEFNSRKLEKRNVFEGLHKNR 2 CQVFNEFN+RKLEK+NVFEG+HKNR Sbjct: 925 CQVFNEFNARKLEKKNVFEGIHKNR 949 >ref|XP_002279888.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Vitis vinifera] Length = 1012 Score = 148 bits (374), Expect = 4e-34 Identities = 67/85 (78%), Positives = 79/85 (92%) Frame = -2 Query: 256 MHKPPVGRVAPLITNVMWRNLLAQSLYQIVILLTFQFKGKSIFNVNERVKNTIIFNTFVL 77 M +PPVGR PLITN+MWRNLLAQ+LYQI +LLT QFKG+SIF VNE+VK+T+IFNTFVL Sbjct: 861 MDRPPVGRTEPLITNIMWRNLLAQALYQIAVLLTLQFKGESIFGVNEKVKDTLIFNTFVL 920 Query: 76 CQVFNEFNSRKLEKRNVFEGLHKNR 2 CQVFNEFN+RKLEK+NVFEG+HKN+ Sbjct: 921 CQVFNEFNARKLEKKNVFEGIHKNK 945 >ref|XP_002283579.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Vitis vinifera] Length = 1017 Score = 147 bits (370), Expect = 1e-33 Identities = 66/85 (77%), Positives = 79/85 (92%) Frame = -2 Query: 256 MHKPPVGRVAPLITNVMWRNLLAQSLYQIVILLTFQFKGKSIFNVNERVKNTIIFNTFVL 77 M KPPVGR PLITN+MWRNLLAQ+LYQIV+LLT QF G+SIF VN++VK+T+IFNTFVL Sbjct: 866 MEKPPVGRAEPLITNIMWRNLLAQALYQIVVLLTLQFNGESIFGVNQKVKDTLIFNTFVL 925 Query: 76 CQVFNEFNSRKLEKRNVFEGLHKNR 2 CQVFNEFN+R+LEK+NVFEG+HKN+ Sbjct: 926 CQVFNEFNARELEKKNVFEGIHKNK 950 >ref|XP_002274787.1| PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Vitis vinifera] Length = 1081 Score = 145 bits (367), Expect = 3e-33 Identities = 66/85 (77%), Positives = 79/85 (92%) Frame = -2 Query: 256 MHKPPVGRVAPLITNVMWRNLLAQSLYQIVILLTFQFKGKSIFNVNERVKNTIIFNTFVL 77 M +PPVGR PLITNVMWRNLLAQ+LYQI +LLT QFKG+SIFNV+E+V +T+IFNTFVL Sbjct: 904 MQRPPVGRTEPLITNVMWRNLLAQALYQIAVLLTLQFKGESIFNVDEKVNDTLIFNTFVL 963 Query: 76 CQVFNEFNSRKLEKRNVFEGLHKNR 2 CQVFNEFN+RKLEK+NVF+G+HKN+ Sbjct: 964 CQVFNEFNARKLEKQNVFKGIHKNK 988 >ref|XP_002279629.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Vitis vinifera] Length = 1011 Score = 145 bits (367), Expect = 3e-33 Identities = 68/85 (80%), Positives = 79/85 (92%) Frame = -2 Query: 256 MHKPPVGRVAPLITNVMWRNLLAQSLYQIVILLTFQFKGKSIFNVNERVKNTIIFNTFVL 77 M KPPVGR PLI+NVMWRNLLAQ+LYQI ILLT QFKG+SIF V+E+VK+T+IFNTFVL Sbjct: 860 MEKPPVGRKEPLISNVMWRNLLAQALYQIAILLTLQFKGQSIFGVSEKVKDTLIFNTFVL 919 Query: 76 CQVFNEFNSRKLEKRNVFEGLHKNR 2 CQVFNEFN+RKLEK+NVF+GLHKN+ Sbjct: 920 CQVFNEFNARKLEKKNVFKGLHKNK 944