BLASTX nr result
ID: Atractylodes22_contig00054025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00054025 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera] 40 5e-06 emb|CAN65603.1| hypothetical protein VITISV_021511 [Vitis vinifera] 40 5e-06 emb|CAN84036.1| hypothetical protein VITISV_024166 [Vitis vinifera] 45 5e-06 >emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera] Length = 1505 Score = 40.4 bits (93), Expect(2) = 5e-06 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = -3 Query: 262 METSQHQRVVGKLISL*HIRPNTKSEVNLVSQFMH 158 + T+++Q++VGKLI L H RP+ V++VSQFMH Sbjct: 1278 VNTTRYQKLVGKLIYLSHTRPDIAFAVSIVSQFMH 1312 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 371 SQRKYVNEL-NETGTSDCLTAETPDNPNQ 288 SQRKY+ +L ETG S C A+TP +PNQ Sbjct: 1239 SQRKYILDLLKETGMSGCRPADTPIDPNQ 1267 >emb|CAN65603.1| hypothetical protein VITISV_021511 [Vitis vinifera] Length = 491 Score = 40.4 bits (93), Expect(2) = 5e-06 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = -3 Query: 262 METSQHQRVVGKLISL*HIRPNTKSEVNLVSQFMH 158 + T+++Q++VGKLI L H RP+ V++VSQFMH Sbjct: 264 VNTTRYQKLVGKLIYLCHTRPDIAFAVSIVSQFMH 298 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 371 SQRKYVNEL-NETGTSDCLTAETPDNPNQ 288 SQRKY+ +L ETG S C A+TP +PNQ Sbjct: 225 SQRKYILDLLKETGMSGCRPADTPIDPNQ 253 >emb|CAN84036.1| hypothetical protein VITISV_024166 [Vitis vinifera] Length = 1337 Score = 45.1 bits (105), Expect(3) = 5e-06 Identities = 20/46 (43%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -3 Query: 277 SKDDPM-ETSQHQRVVGKLISL*HIRPNTKSEVNLVSQFMHPHKEP 143 +K++PM + +QR++G+LI L H RP+ V+++SQFMH +EP Sbjct: 1050 AKEEPMVDKRMYQRLIGRLIHLAHTRPDIAYSVSVISQFMHDPREP 1095 Score = 27.7 bits (60), Expect(3) = 5e-06 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 371 SQRKYV-NELNETGTSDCLTAETPDNPN 291 SQ+KYV N L ETG C TP +PN Sbjct: 1017 SQQKYVTNLLAETGKIGCKPVSTPMDPN 1044 Score = 21.2 bits (43), Expect(3) = 5e-06 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 53 TNTGRAGSVIDRKST 9 T+ AGS++DR+ST Sbjct: 1129 TDADYAGSLVDRRST 1143