BLASTX nr result
ID: Atractylodes22_contig00053939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053939 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001865702.1| conserved hypothetical protein [Culex quinqu... 55 8e-06 >ref|XP_001865702.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167878709|gb|EDS42092.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 425 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = +1 Query: 190 DGIYPERATMVKSFSHPSDPKRKKFKEKQEASRKDVKRVFG 312 DGIYP +T+V++ S P KRK F EKQEA+RKDV+R FG Sbjct: 281 DGIYPHLSTLVQTISAPVGQKRKNFAEKQEAARKDVERAFG 321