BLASTX nr result
ID: Atractylodes22_contig00053758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053758 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518631.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002518631.1| conserved hypothetical protein [Ricinus communis] gi|223542230|gb|EEF43773.1| conserved hypothetical protein [Ricinus communis] Length = 796 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/77 (48%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = -3 Query: 410 SDPFSGIFTRSKEQIYLHRHRSGYARADSIRNRSLIQRQRTATKSLVSQEPSKATSDHI- 234 S P GIFTRSK +IYLH +RSG AR+DS R I +Q ++P + S I Sbjct: 21 SHPLMGIFTRSKSKIYLHCNRSGRARSDSSR----INKQNPVGLQSKEKKPRQKDSSDIG 76 Query: 233 -TNQVPVKDLRARRVFS 186 + V +KDLRARRVFS Sbjct: 77 EWSCVVIKDLRARRVFS 93